SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37522218|ref|NP_925595.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37522218|ref|NP_925595.1|
Domain Number 1 Region: 333-570
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.45e-59
Family Extended AAA-ATPase domain 0.000000974
Further Details:      
 
Domain Number 2 Region: 67-311
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.48e-56
Family Extended AAA-ATPase domain 0.00000411
Further Details:      
 
Domain Number 3 Region: 583-770
Classification Level Classification E-value
Superfamily FtsH protease domain-like 1.96e-43
Family FtsH protease domain-like 0.0000935
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|37522218|ref|NP_925595.1|
Sequence length 785
Comment cell division protein FtsH-like protein [Gloeobacter violaceus PCC 7421]
Sequence
MLAFEILQSFVNFLGFLLLILVQGMVFAFAYLLIFVGGTGLGKGAKARRPSSGGPLARWL
GRYREGERDREVRFCDIVGLEEAKQELEQLVDVLKRPESYRVVGAEPPRGVLLVGPPGTG
KTMIARAIANEAGVPFYSLAAADFANMFLGVGSQRIRQIYRTARRHPRAIVFIDEIEVLA
KARGTGLGTFEGDSNTLNAFLNELDGFAINPGVITIGATNLEDQVDAAVMRPGRLDWQIY
IGPPAEADREKLFRFYLERTCNTADPAAAAKLAVNFTPAEIRRAVNEAGLLAVRGGRVEI
AESDLTTAVDKVSATLERRSGTFIIGRSGDLAVRLAEVIGCEEAKGEVQEFIDFLRSPDR
YRRIGAKVPRGFLFVGPPGTGKTLLAKAIANEAGVPFYALSGSDFTEVWVGLGASRVRQV
YRQARKHKAAIVFIDEIDALAARRGLDSSGEADRTLNQFLVELDGFGRSNVLTIGATNRL
DTLDPALLRPGRLDRTVAVPLPDLDARERLFEHYLARVQAVVGINCRQLARASWNMSGAE
VAASVNEASFIAVRDGRGQVTQFDLNQGIERVLFGLNSRRKVNAEDRRLAALHEAGHAVV
EYHARPRRILHKLTISPDLEGTAGYSWSIQDEEQLSFETREGIRAEIQVLFGGRVAEELF
YGTVTTGAGADLARAAHLAHRYVWQLGMGEEFLADYAQMAAAAAGGRVISERTKERLDLA
VEKLLREAKSEARTILEAHRDEHERLTAALLERESLYGEDILRVLRGETIEPSGRAACKD
DGGDG
Download sequence
Identical sequences Q7NH88
251221.glr2649 NP_925595.1.44878 gi|37522218|ref|NP_925595.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]