SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37522228|ref|NP_925605.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37522228|ref|NP_925605.1|
Domain Number 1 Region: 571-612,679-899
Classification Level Classification E-value
Superfamily Protein prenylyltransferase 1.09e-18
Family Protein prenylyltransferase 0.03
Further Details:      
 
Weak hits

Sequence:  gi|37522228|ref|NP_925605.1|
Domain Number - Region: 486-641
Classification Level Classification E-value
Superfamily TPR-like 0.00152
Family Tetratricopeptide repeat (TPR) 0.025
Further Details:      
 
Domain Number - Region: 12-84,233-345
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.012
Family G proteins 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|37522228|ref|NP_925605.1|
Sequence length 907
Comment hypothetical protein glr2659 [Gloeobacter violaceus PCC 7421]
Sequence
MPDGITEEYFALQHFTNRHSLTRRFATRLHSNPTPQTVLCLHGDGGNGKSLLLRYWYESA
CKLFQDWEQANANDDDRDFVNRLTALPNSHYLPILSVFHDFGQPGCNEEQPQHDLYGTLM
IHNALVQAAITRGLKHCFVFPRFSFAIAWSLHRTGKSKQEIRPLFPTDAVFDFVAAIVDS
AIGIPIATAGNAVRRIIANYTLPTDEQQLRVQFEGQLDEHWMRELCQRNPRRDLLPKLPE
LLAKDINDAMARFPKARIVLLFDAHQAFWGTEQDAAPGSYHQRDEWFRRFLLSLDLAGGI
VVVVASREPPRWSEASRHPISRKHLESELVGHLTEADGREYLQKLNISTPTLQSSMLRYA
SVRDGEIHPLYLALCADLVLAARNQEEEIQADTFAQSASQTNKPRELLERLTHYANEKLL
DILEALSACRSFDLSVFRVLGQSLNFDTDDATFRVLCRYSFVWPTQNRNGSYRIHDLMRR
LNTQFDTELTRRAHELLIDYYQREGNLAESIYHCYCLDQKQGIASWWPEFLRAERFGNYE
LCRNLLDVLVLMDISGLDKVTVLLSVGLYFANLGQLDEARSRFTEAIDVSDELLALEPQN
VSFVVNKSSALMDLADIQARTVGVDEAIQVLRQAIAVVENALESGLGNTTDDDKYLTVNK
LRGLFDLAVLLKYVSILEAKERLNEALLLCRETLLIFPDFTSVLFRSGLILDHLARMAEH
EPQLSNPEDIYNESISTYDRLLELQPENFNGYKNRAVTFDNLARWKSLLNDCAGAEENFV
SSIINYDIALELSPDYFGGYFAKGNTLFASYRNLLKMDRYPEALQRLNEAVEAYSEALQR
IPNNINCIKMKGLALFEAVYLSSYLSLSDSVSLFLQNALVAFETYLQNCPDDLDMQEKLS
CLRSFSD
Download sequence
Identical sequences Q7NH78
251221.glr2659 NP_925605.1.44878 gi|37522228|ref|NP_925605.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]