SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37522324|ref|NP_925701.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37522324|ref|NP_925701.1|
Domain Number 1 Region: 494-983
Classification Level Classification E-value
Superfamily ALDH-like 7.72e-146
Family ALDH-like 0.00000000385
Further Details:      
 
Domain Number 2 Region: 131-460
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 2.94e-93
Family Proline dehydrohenase domain of bifunctional PutA protein 0.0000179
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|37522324|ref|NP_925701.1|
Sequence length 996
Comment 1-pyrroline-5-carboxylate dehydrogenase [Gloeobacter violaceus PCC 7421]
Sequence
MELPPFQETRVLTVDPIESETQRIGQSLLAAPQQSRFSFFERSFWDEKLLEWAMADDELR
VQLFRFIDCLPALKTNREVASHLQEYLGSVKLPGPLAKALDFADPGSPAAAVATLGLRQG
ISQMARRFICGENLKTAVKTIEKLRSQNMAVSLDLLGEAVVSEAEAEVYQRRYLELLSDL
HAAQSRWPVIDQIDRADGQLLPRVHFALKLTSLYSQFDAIDPATTGRNVKARLRPILRKA
RELGAFVHIDMEQSQHKDLILQIFKEVMVEADFRDWIDTGICLQAYLRSAELDAANVIAW
SKERGYPVTVRLVKGAYWDGEVIRAAQQRWPVPVFTRKADTDAQYEKVLHLLMENHRSVH
IAVGSHNARTVALAIALARRNRVPRRAFEVQMLYGMADHLKAGVAQQGERLRVYAPYGEL
LPGMAYLIRRLLENTANTSFLRQSVRPGSDVVRLLAPPAASGEAAPSLMGSEFVNAPDRD
FAVAAEREKLAAGLAEVRTCFGQTYWPVVGGKARRGLPTLSVPNPAEPGTVLGALGLADA
ELADEAVKVAHTAWLSWSKTTPEARARLLGRLAELMEQQRSALTAWIVYETGKPWRESDA
DVSEAIDFCRYYGRQILKLTAQAQHRDVPGETNGYHYRSRGVAAVIAPWNFPLAILTGMT
TAALATGNTVIMKPAEQSSIVAAQLMRLCEQAGFAAGVVNYLPGRGEVVGAKLVAHPQVH
LIAFTGSLAVGQRILAEASMVRPGQRHLKRVIAELGGKNAIIVDSDADLDQAVVGVVQSA
FGYSGQKCSACSRLIVLEGIYDVFIERLVQATRSLIVGNPAQPATYTGPVIARDACERIR
GVIEDAKGRHRLVLEVDVSHLGEGYFIGPTIFADVDPQSSLAQEEIFGPVLAVIKARDFE
HAIEIANGTSFALTGGLFSRSPRHIAEARERFEVGNLYINRKITAALVDRQPFGGFRLSG
VGSKAGGPDYLLQFVEPVTVTENIQRQGFAPLPGEL
Download sequence
Identical sequences Q7NGY2
251221.gvip380 NP_925701.1.44878 gi|37522324|ref|NP_925701.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]