SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37522348|ref|NP_925725.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37522348|ref|NP_925725.1|
Domain Number 1 Region: 106-322
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 6.36e-59
Family BC ATP-binding domain-like 0.000003
Further Details:      
 
Domain Number 2 Region: 3-104
Classification Level Classification E-value
Superfamily PreATP-grasp domain 9.11e-35
Family BC N-terminal domain-like 0.0000282
Further Details:      
 
Domain Number 3 Region: 328-422
Classification Level Classification E-value
Superfamily Rudiment single hybrid motif 3.77e-29
Family BC C-terminal domain-like 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|37522348|ref|NP_925725.1|
Sequence length 426
Comment phosphoribosylamine--glycine ligase [Gloeobacter violaceus PCC 7421]
Sequence
MALKILVVGNGGREHCLAWALARSEGVGRIWVAPGNGGTATESKCANLAVSPLDFAALAD
FAHSERVDLTVVGPEAPLAAGIVDYFQAEGLIIFGPTREGAQLEASKAWAKHLMHEAGVP
TAAARSFADIEAARAYVRELGAPLVVKADGLAAGKGVTVAMETAEALAALDELPRFGAAG
ATVVIEEFMAGEEASVLAFTDGKTIRAMVPAQDHKRVGEGDTGPNTGGMGAYAPAPLVDA
ALMRQIEERILAPTLTALQKRSIDYRGVLYAGLMIGPDSSVRVIEFNCRLGDPETQVVLP
LLETPLEEVLLATAQGSLDRVDLQWKPGAAACVVLAAGGYPGDYRQGDVITGLEEARAQG
GLVFHSGTRREKERILSAGGRILAVTALGDALESAIASAYQVVNCIAVKDVHYRRDIGWR
ALQLCK
Download sequence
Identical sequences Q7NGV8
251221.gvip382 NP_925725.1.44878 gi|37522348|ref|NP_925725.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]