SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37522373|ref|NP_925750.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37522373|ref|NP_925750.1|
Domain Number 1 Region: 355-534
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.95e-60
Family Pyruvate oxidase and decarboxylase PP module 0.0000572
Further Details:      
 
Domain Number 2 Region: 1-165
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.99e-54
Family Pyruvate oxidase and decarboxylase Pyr module 0.0000262
Further Details:      
 
Domain Number 3 Region: 180-360
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 1.12e-42
Family Pyruvate oxidase and decarboxylase, middle domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|37522373|ref|NP_925750.1|
Sequence length 545
Comment acetolactate synthase [Gloeobacter violaceus PCC 7421]
Sequence
MNTAELLVQCLENEGVRYIFGLPGEENMQFLEALQSSSIQFVTTRHEQGAAFMADVYGRL
TGRAGVCLSTLGPGATNLMTGVADANLDRAPLVAITGQVGTDRMHVDAHQYLDLVAMFAP
VTKWSTHIVRPSNTPEIVRKAFKIAQAEKPGAVHIELPENIASMAAIGEPLRISDNHDIF
ASFSSITRAAELISQADNPLILVGNGAIRCNASAALTEFAARLNIPVANTFMGKGVIPYT
HPLALWAVGLQQRDYISCGFDRADLVIAIGYDHIEYSPKKWNPMGDIPIVHVGRTAAEVD
SSYIPQVEVVGDISDSLQEILSRADRQGKPDPYAIQLRDDIRAEYTEYAHDTGYPVKPQK
IIYDLRQVLGSEDILISDVGAHKMWVARHYHCDRPNTCIISNGFAAMGIAIPGAVAAKLV
HPHRKVVAVTGDGGFMMNMQELETALRIGTPFVTLIFNDGGYGLIEWKQQTHFNRSAFVR
FGNPDFVRLAESMGLKGYRVEAGDELLPILKTALEQEVPAIIDCPVDYRENMELSQRVMQ
LSCAV
Download sequence
Identical sequences Q7NGT4
gi|37522373|ref|NP_925750.1| NP_925750.1.44878 251221.gvip386

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]