SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37522408|ref|NP_925785.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37522408|ref|NP_925785.1|
Domain Number 1 Region: 298-500
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 6.93e-53
Family Multidrug efflux transporter AcrB transmembrane domain 0.00000298
Further Details:      
 
Domain Number 2 Region: 828-1023
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 6.28e-48
Family Multidrug efflux transporter AcrB transmembrane domain 0.00000476
Further Details:      
 
Domain Number 3 Region: 39-131
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 1.05e-27
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.00023
Further Details:      
 
Domain Number 4 Region: 563-666
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 1.88e-26
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.001
Further Details:      
 
Domain Number 5 Region: 141-183,276-331
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 3.31e-25
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0029
Further Details:      
 
Domain Number 6 Region: 670-718,805-854
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 1.2e-24
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0021
Further Details:      
 
Domain Number 7 Region: 719-804
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 9.16e-21
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.00067
Further Details:      
 
Domain Number 8 Region: 184-274
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 2.62e-20
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|37522408|ref|NP_925785.1|
Sequence length 1059
Comment RND multidrug efflux transporter [Gloeobacter violaceus PCC 7421]
Sequence
MFVNYFVQRPILTIACSVIIVLGGWVSIRTLPVDQYPDIALPQVVVTARYDGASAEVVES
TVTTPLEQQINGAESMRYMTSTSSNDGTSTITVTFDLARNIDDAAMDIQNRLTAVQGRLP
EEVRRTGVTIRKNASQVTVAFGLYAKNNEYDNTFISNYADLYISDALRRVKGVGDVRIFG
ERRYSMRLWLDADRLAARRLSAVDVVRALETQNLQVGAGQVGQPPSLDGQPYQISVRAVG
RLKSPAQFDNLILKRGADGALVRLKDVGRTELGAEDYTTFLRFTGRNAVGIAVSQLPGAN
TLDVYREVKAELDRQARAFPPGLEYEIAFDSASMVDESIHEVVKTLIEAVVLVVAVMFIF
LQDWRGTLIPAIAIPVSLVGTFIFVKLLGFSINTLTLFGITLAAGLVVDDAIVVVENIVR
YSRERGLTVRAAAPEAMREVFGAVIATSLVLVAVFVPVAFFPGTAGRLYQQFALTLTFSI
ALSTFIALTLTPTLSALLLRAEPPRHWLFDRINDLIDWLRRGYARSLGFALRFRSAMLGV
FVCLLGLAWWLFGKVPPGFVPNEDQSYFVVFVQCPEGSSLDYTNKVMLQVEQELRKLPEL
ARMFAIGGYSPSGNAPNKATIFPHLLPLAERRQPSQSVDAIIDKVRGPLSRIPGATVAAF
PMPAIQQGVGQFGGFQLQVQDQRNLGLETLAGVTRTLVEQGNAQPGLSGLFSSFSINDPQ
LVVEVNREKAEALAVAPDEVLKALQIYMGSLYVNDFEMFNRPYRVYVQADRRFRSTPQDL
RRFYVRSQTGAMIPLGNLVTVSRTVAPQIINHYNMLRSAEVNGAPAEGFSSGQAIEQMQK
LAEQVLPQGIRFQWSGVSLEQIESGNKALFIFVLGVVFVFLVLAAQYESLTDPLVIMLSV
PLAIVGALGAQALRGLENDIYCQIGLVMLIGLASKNAILIVEFANQLCKEGLTRIQAVSK
AAQIRLRPILMTSFAFILGVVPLVMAEGAGAAGRQSLGTAVFGGMLVSTALSLYIVPVLY
IVIGALRERFKGDRTAPDLLTHDSSTQSNALEIPSPSQK
Download sequence
Identical sequences Q7NCY7
251221.gll2839 gi|37522408|ref|NP_925785.1| NP_925785.1.44878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]