SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37522412|ref|NP_925789.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|37522412|ref|NP_925789.1|
Domain Number - Region: 15-60
Classification Level Classification E-value
Superfamily EspE N-terminal domain-like 0.000243
Family GSPII protein E N-terminal domain-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|37522412|ref|NP_925789.1|
Sequence length 63
Comment hypothetical protein gsr2843 [Gloeobacter violaceus PCC 7421]
Sequence
MPEAIQMTHQLAAENYLLHHRLITGAQLERARRLALLWQGDLPIVLWKIGLIDLATLASL
IDL
Download sequence
Identical sequences Q7NCY3
NP_925789.1.44878 251221.gsr2843 gi|37522412|ref|NP_925789.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]