SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37522587|ref|NP_925964.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37522587|ref|NP_925964.1|
Domain Number 1 Region: 95-197
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000000021
Family HtrA-like serine proteases 0.094
Further Details:      
 
Weak hits

Sequence:  gi|37522587|ref|NP_925964.1|
Domain Number - Region: 13-104
Classification Level Classification E-value
Superfamily FtsH protease domain-like 0.0128
Family FtsH protease domain-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|37522587|ref|NP_925964.1|
Sequence length 350
Comment hypothetical protein gll3018 [Gloeobacter violaceus PCC 7421]
Sequence
MFVLLSILVLGLLIVVHELGHFLAARWQGIRVSRFSIGFGPVIARYQGPEVEYALRALPL
GGYVGFPDDDPDSGIPKDDPHLLKNRPILDRTIVLLAGVTANFVFGYLVLLALVVLGGVP
ETQVRPGALIQQVTAGQAAERTGLEAGDVVLEAAGRPVGSGDGALAQLSRVFQANADKSV
NLVVQRGEERRPVALTPNAQGKVGVSLSANGTVTRRAPRDIAEVFTSSATAYGRIAVTTL
NGFGQLFTGRAGLDQLTGPVGIVAVTAQAAQSDWLNLFYVAALISFNLAVLNLLPLPALD
GGQLVFVIAEALRGKPVPDKIQNYVNQAGMLVLLGLGVLLIFRDTFNLLQ
Download sequence
Identical sequences Q7NCG1
251221.gll3018 NP_925964.1.44878 gi|37522587|ref|NP_925964.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]