SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37522595|ref|NP_925972.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37522595|ref|NP_925972.1|
Domain Number 1 Region: 76-326
Classification Level Classification E-value
Superfamily Nitrous oxide reductase, N-terminal domain 5.23e-34
Family Nitrous oxide reductase, N-terminal domain 0.026
Further Details:      
 
Domain Number 2 Region: 333-424
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.00000051
Family Carboxypeptidase regulatory domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|37522595|ref|NP_925972.1|
Sequence length 606
Comment hypothetical protein gll3026 [Gloeobacter violaceus PCC 7421]
Sequence
MQAMKRAAIGTVLLLLAAGSLPARAAEVTVPLGARADKIEVLYTKQGPMALVGLLDEEAL
AVVDLTSKQIKSRTPLGIRPLVVRRIGATNVAAVGGPASGNLVLVDFEKQEVTRQIDLGS
GIFDIAVDAERGRIVVTHPAADRISVVNPSTGQVRIFPMPGPPLAAAIQSANGNLLVTLG
GSDPLGLAIVNLANGELLARLRSGATPEDMVLDLVHQQAVVLNSGSNDLTLVPLSATART
VRTVGLDWRPSRLVLSRDGRYAYVTSGESDRLQIVDLEAGQIVKSRPLGRLPTGIVLLED
DSLLVAEAGTQALRRITPESFAVSELPPLQPGSVAGVITDVAGKPITKGVLKVEGRTVPI
LPDGSFLISKLPAGKYLVDVQVPGFPAFSARLQAREGYVVTDEIRLPPRSQAEKVDGVGF
IADVPQYSELLARTLVERLAGKEKTRKVILLNGPLGPHPEFVQLASTVRDLNLLDRDNRY
TDDLEKLQTIGRSLGLRYIVVTQVQFTRGYNTQGDPIINTLLRFFVPVSLPNFSPNQLRS
QAVAVVVDLQKVRSGDKAMLFKAEDRDDTGGPPLFEEAADGLFRLEVKRMAEQIDNQWKE
KSPFIS
Download sequence
Identical sequences Q7NCF3
NP_925972.1.44878 251221.gll3026 gi|37522595|ref|NP_925972.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]