SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37522656|ref|NP_926033.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37522656|ref|NP_926033.1|
Domain Number 1 Region: 106-189,218-393,549-663
Classification Level Classification E-value
Superfamily Subtilisin-like 9.3e-57
Family Subtilases 0.0029
Further Details:      
 
Domain Number 2 Region: 461-541
Classification Level Classification E-value
Superfamily PA domain 0.00000288
Family PA domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|37522656|ref|NP_926033.1|
Sequence length 1054
Comment hypothetical protein glr3087 [Gloeobacter violaceus PCC 7421]
Sequence
MSLAVSLPLTTSPLLAAERLPVGFQKKVPFAQTQNLLRSSAGRGVVPADSQGRVRAIVQF
VEKPTVLMRRGADLRSAEARDYGEQLARLRAARLEQIERLGGRVQSVLSNVLNAAVVEVA
QERIPQIRRLAGVKSVRPARVYRPDQSPPGSVGELIGTTALQQAGITGEGVVIAVVDSGV
DYTHAALGGTGTVAAYQAAVSGSAPLAVGDSPDFPNAKVIGGFDYLGETWTGNSADPGGL
AVTPDPDPVDNKQTDTDFAGHGTAVSSASAGLPLPQSGLAGGTAPGAKVLAYRGCSRISA
SCEGSALLNSIEAAVAFDVSGAFPGYPNPVRKVINLSLGAAFFDPSVDDLSEAVRNAVEA
GVVVVASAGNSGDLPYATGTPGSTETVIGVAASLPPLNIGPGLEVPTLGVTYQLGVAQFG
PALTEPLTTTFKLAGSAEINLACSNPPNQNPPAPAEPPIADLSGSTGIADRGDCEFSEKV
YNLQQAGALAGLIVNNAPGVLTMAPGAAASLVTIPSFIIDQEQGTTLKAALAGDPGLTAT
FIPQLSIPNPNFDQIADFSSRGPSPALNRIKPDITAPTNTFEANIGTGNLGAEFGGTSNS
APVTSGVAALVLSKYPAYTPNQVKTALMNSANPQVFADKAAGTVVPIARQGAGRVQADRA
ANLQTLAFDAADPARPASLSLGYRVFPKSETLTRTVAVQNLSGSAKTYTLSVQPRYPEDA
GKGVSFQVPDTLSVPAGQTRTFAVTVNVRSDLLPAGGLDAGLGGNDTAAFSAFEQDGYIT
IDGGADNTVSLPYLLLPRKGSEVQASSQAGPKAVLVNAGVAATTAQVFNLAGSDPQDLPG
PEAGENAINTDIKEVGLRFLPATGDTAETIEFAVSLYRPFTNPRNAPVQIDVDVTGDGIA
DYFVFNYDLELLTGATTGQNVTYILEAATGLLIADFYTQLNYNAGQLVLPVLAASIGATA
ETRLQLRAVTGSTALGFFGQTDLAPDSGLYAFTPAKRVTAAAATSVAVPALGTASVDFTV
ERTNAGASPSDAGLLFVLPDNPLASQTDSLRIAR
Download sequence
Identical sequences Q7NC92
gi|37522656|ref|NP_926033.1| 251221.glr3087 NP_926033.1.44878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]