SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37522695|ref|NP_926072.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37522695|ref|NP_926072.1|
Domain Number 1 Region: 400-475
Classification Level Classification E-value
Superfamily E set domains 0.00000000000056
Family E-set domains of sugar-utilizing enzymes 0.018
Further Details:      
 
Domain Number 2 Region: 225-303
Classification Level Classification E-value
Superfamily E set domains 0.00000000000238
Family Other IPT/TIG domains 0.035
Further Details:      
 
Domain Number 3 Region: 48-121
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000863
Family Cadherin 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|37522695|ref|NP_926072.1|
Sequence length 488
Comment hypothetical protein gll3126 [Gloeobacter violaceus PCC 7421]
Sequence
MLPMQRRFKSTIVAMLAGAALIFWPCRTVDAQGVPVLIDTALPSGNLEQEYRYTLRVVGG
TAPYTWSVIGGSLPNGLTLDSNSGQLVGTPNTTNINNTFTVQTTDSAGLTATRTFTFAVA
GRGYRLEPAVGNLTVLQGRTASLPLQVVGEAPQVTSPIGFNLLTAPPAGVVAAFEPPQLA
STGGPVNFVVAAEATAAPGTYPLNISAVSPPYQQSATINLIVQPPPPEITGFSPPGGLPG
TAVTVRGTRLTGTTALTIGGRRANFTVLSATQLSVVVPAGAATGRIVASTPAGNATSAAD
FVVPTFKLIVNPAVVAVRPGQEAVFAVGITGRLDSLVDLELGGLPDDWNAQYTPDFLDGQ
NTRSQLRVQAPSDANLGDYALTVAANVVRATATVRIVGIAPRLTRLTPVRGPAGTVVTLS
GQNFQPGVRLQIGTVDLAVLSVSDTQVQARVPLGATTGRIRLLNPDDQQATTSTVFVVEA
ATNPPGQP
Download sequence
Identical sequences Q7NGP2
NP_926072.1.44878 gi|37522695|ref|NP_926072.1| 251221.gll3126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]