SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37522760|ref|NP_926137.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37522760|ref|NP_926137.1|
Domain Number 1 Region: 17-188
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 1.81e-44
Family Pentapeptide repeats 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|37522760|ref|NP_926137.1|
Sequence length 192
Comment hypothetical protein gll3191 [Gloeobacter violaceus PCC 7421]
Sequence
MIEAEKIKQGEVEDLRGAGLEGIDLAGVRLERHNLAGANLTGAHLAGAVLHCDLWGANLM
GANLSESDLRGANLRGANLMSANLQNASLGGANLEGTNLMGLNGIGADLRHADLRGARLS
GANLAGADLSGANLAGADLRGADLEEANLSSAAVAGASFAGANLLCADLSGIDTRLADFE
GACLVGTLLDAV
Download sequence
Identical sequences Q7NGH8
gi|37522760|ref|NP_926137.1| NP_926137.1.44878 251221.gll3191

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]