SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37522910|ref|NP_926287.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37522910|ref|NP_926287.1|
Domain Number 1 Region: 1-277
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 3.76e-74
Family Cytidylytransferase 0.0058
Further Details:      
 
Domain Number 2 Region: 239-433
Classification Level Classification E-value
Superfamily Trimeric LpxA-like enzymes 2.35e-30
Family gamma-carbonic anhydrase-like 0.069
Further Details:      
 
Domain Number 3 Region: 637-744
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 3.1e-17
Family Phosphoglucomutase, first 3 domains 0.005
Further Details:      
 
Domain Number 4 Region: 747-831
Classification Level Classification E-value
Superfamily Phosphoglucomutase, C-terminal domain 0.000000000000262
Family Phosphoglucomutase, C-terminal domain 0.0056
Further Details:      
 
Domain Number 5 Region: 538-632
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 0.0000000000942
Family Phosphoglucomutase, first 3 domains 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|37522910|ref|NP_926287.1|
Sequence length 835
Comment mannose-1-phosphate guanylyltransferase [Gloeobacter violaceus PCC 7421]
Sequence
MRAVLMAGGSGTRLRPLTCDLPKPMVPILNRPISEHILNLLKRHGVDEVIATLYYLPDVM
REYFRDGSDFGLRMTYAVEEEKPLGTAGCVKNIENLLHETFIVISGDSLTDIDLSAAVAF
HKEHGSKATLVLARVPDPMEFGVVITDAHGRIVRFLEKPSTSEVFSDTVNTGTYILEPEV
LEYLPADTEVDFSKDLFPKLLAKGEPMYGYVAEGYWCDVGSLDTYREAQYDALAGKIRLE
HGYRQHAEGIWIGDNTLVDPSVHLEPPLIIGHNCRIGPRARLSAGTIIGDNVTVGAAADL
KRPVIWNGAIIGEEVHLRGCTIARGARVGRRAQLLEGSVVGALTTVGDEAVIAPEVRLWP
SKKVEVGAHVTMNLIWGTTAIRNLFSQRGVSGLANVEITPEFAVKLGAAYGATLKPGAQV
QVSRDQRAISRMISRSLVSGLMSVGVNVQNLEATAIPIARYVAPMLEVNGGIHVRVHPEH
NDRTLIEFFDSQGINLGKSREKKIESAFFKEDFRRARIDEIGEITYPSRTLEFYGAGFID
HLSAVALRNSPARVVIDYAYGVSGAVLPTLLGKLGCEAVVLNAALTPNAPPTSKQRESLL
TQLGNVVEALQATFGVQIFANGERFTLVDEAGAAIKDEQLTALLVELVLTDSPRAVVVVP
TEVSGVVEQIAHRHDGRVVRTKASPTALMEAAAATNNVALAGSAEMGFIFPQLHPGFDAM
FAVARLIEMLAEQERSLSQTRQDLPRIHHRHHVIHCPWNAKGAMMRQLVESHPEESLELM
DGVKVHFSKEDWVLILPDAGEPLVHIYSNGHNRESVERMARKYREVVQEFTRDRR
Download sequence
Identical sequences Q7NG32
NP_926287.1.44878 251221.gll3341 gi|37522910|ref|NP_926287.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]