SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37522932|ref|NP_926309.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37522932|ref|NP_926309.1|
Domain Number 1 Region: 222-343
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 3.43e-43
Family C-terminal domain of the electron transfer flavoprotein alpha subunit 0.0000555
Further Details:      
 
Domain Number 2 Region: 5-201
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 4.33e-43
Family ETFP subunits 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|37522932|ref|NP_926309.1|
Sequence length 361
Comment electron transfer flavoprotein, alpha subunit [Gloeobacter violaceus PCC 7421]
Sequence
MSTKQVLIFVEQEDGCARPVAFELLGAGRMLANKLGAELAAFVACDSVGELPETLVAHGA
DRVYVAEHPELATYRTLPYRRVLIDLIAAMDTPPHIVLFGSTTTGRDLAPRIAAYFETGL
TADCTELDIGPYEHTNAQDPSKVGLYPDCLYAIRPSFGESLKARILGPWKNPQMATVRSG
VMVPLAPDATRTGVVQSVPVHLESADLQLVVAETLRSLGEQVELQGAEVIVSGGYGLGNP
EGFALMYQLAACFENSAVGSSRKAVDAGWIAHAHQVGQTGKTVRPKLYIACGISGAIQHR
VGMDKSATIVAINKDSNAPIFKFAHHGIVGDLHQVIPELIRQLKLQKTSTPDTSHVATHS
L
Download sequence
Identical sequences Q7NG11
gi|37522932|ref|NP_926309.1| 251221.gll3363 NP_926309.1.44878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]