SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37522950|ref|NP_926327.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37522950|ref|NP_926327.1|
Domain Number 1 Region: 32-82
Classification Level Classification E-value
Superfamily EspE N-terminal domain-like 0.0000942
Family GSPII protein E N-terminal domain-like 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|37522950|ref|NP_926327.1|
Sequence length 89
Comment hypothetical protein gsr3381 [Gloeobacter violaceus PCC 7421]
Sequence
MIPKPLTEYYVLLTSNLRKASAWEGVVGSEQKELERYLLNNGIVNRRELELAKKVQRAQQ
GPLPILLWQLSFITLVQLGALLDWSGQLS
Download sequence
Identical sequences Q7NFZ3
NP_926327.1.44878 gi|37522950|ref|NP_926327.1| 251221.gsr3381

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]