SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|37523124|ref|NP_926501.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37523124|ref|NP_926501.1|
Domain Number 1 Region: 1-128
Classification Level Classification E-value
Superfamily PIN domain-like 1.88e-20
Family PIN domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|37523124|ref|NP_926501.1|
Sequence length 128
Comment hypothetical protein gll3555 [Gloeobacter violaceus PCC 7421]
Sequence
MRLLLDTHVFLWWVEDAPQLSVSARTAVADPQNVCLLSLASCWEMAIKASLGKLKLPSAL
ENFIPEQLLINGFQTLDIDFRHIVRVSGLAFHHRDPFDRLIIAQALEERLVVASADSVFE
KYDLQRVW
Download sequence
Identical sequences Q7NFH0
NP_926501.1.44878 gi|37523124|ref|NP_926501.1| 251221.gll3555

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]