SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37523188|ref|NP_926565.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37523188|ref|NP_926565.1|
Domain Number 1 Region: 820-1040
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 4.58e-51
Family Multidrug efflux transporter AcrB transmembrane domain 0.00016
Further Details:      
 
Domain Number 2 Region: 313-514
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 3.53e-32
Family Multidrug efflux transporter AcrB transmembrane domain 0.00061
Further Details:      
 
Domain Number 3 Region: 61-152
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 3.14e-21
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0024
Further Details:      
 
Domain Number 4 Region: 167-203,290-347
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 3.4e-19
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0065
Further Details:      
 
Domain Number 5 Region: 735-820
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 1.05e-16
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.006
Further Details:      
 
Domain Number 6 Region: 204-287
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.00000000000000262
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.0027
Further Details:      
 
Domain Number 7 Region: 578-677
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0000000994
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|37523188|ref|NP_926565.1|
Sequence length 1089
Comment cation efflux system membrane protein CzcA-like protein [Gloeobacter violaceus PCC 7421]
Sequence
MTTAYQPETAGSPQVQPKGFLAQWIYWALKQRLLALLVLLVIVGVGINSVMRLPLDGLPD
ISNVQVQVITEAPALGPQEIEQLITFPVEIALTGMPRLNQMRSISKYGLSQITVVFEDGT
DIYFARQLVNERLKDAEGLLPAGSERPVLGPVSTGLGEIYVFELKGDGRYTPMELRTIMN
WTVIPRLKSVRGVAEINPMGGFVKQYQVKLDPERMLGYSITPQMVFSALETNNANSGGGY
STDGSGEQTIIRGEGLVTSTSDISDVIVDRSHGTPVYLRDVAEVVIGNQLRQGVVTRNGT
DGTVVATVLMRAGQNANGVIKDVKARVAELQKELPEGVEIVPHYDRTQLITAAIKTVAIN
LIEGALLVTAILLIMLGNIPGSLITALIIPLSMLLAITGMVIGGVSGNLMSLGAIDFGLL
VDGAVFMVENIILRLSEQRPETPKERMAVIGAASAEVAKPVAFAITIVTVVYIPIFGLSG
VEGKLFQPMAFTVILALVASLVLTLSLVPLACYFAFSKKLPEERETLVIQWLRPGYEKGV
TWLMGKWLPVSAVCTAIFVASLTLVPLLGSEFVPNLSEGSMVINMRRPPAASLDEGARQT
KILEKAIKEFPEVVTAVSFTGHPELATDTNKSENSDILVILKPQKEWKTAKTQPELVKKI
EKRLTGIVPGVTVAYTQPIQQRVNELLSGDRLDIALRIYGPEINELDRLAGQAAGVIKKV
QGAADVRAETVRGLPVFNIKVDRQRLAQYGINVREVLDTIEATRAGKVVGTIYEGRQRFS
LAVKFDEDAVRDLEDTRRLPVSTEDGRIVPLGAVVDITTSDGIAQISHREGERVITVGMN
VRDRDLGSFVAAAQQAVESQISAPKGYRLVWGGQFENYQSALSRLQILVPLALALIFLLL
YSSFGNLRPGILIFLNVPFSLVGGLVALYLRGMPLSVSAGVGFITLFGVAVLNGIVLVST
IRTMQEAEGLSAEKAALKGAKERLRPILSAALLASIGFIPMATATSAGAEVQQPLASVVI
GGLITCTFFTLFALPVLYPVICGGSSPGGSAPRTNLSLWERLQKLFGQYSAAPKPRPGIE
PARVEPPPA
Download sequence
Identical sequences Q7NFA7
251221.gll3619 NP_926565.1.44878 gi|37523188|ref|NP_926565.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]