SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37523191|ref|NP_926568.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37523191|ref|NP_926568.1|
Domain Number 1 Region: 300-388
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 0.000000000222
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0049
Further Details:      
 
Weak hits

Sequence:  gi|37523191|ref|NP_926568.1|
Domain Number - Region: 23-99,137-213
Classification Level Classification E-value
Superfamily Dihydropteroate synthetase-like 0.0251
Family Dihydropteroate synthetase 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|37523191|ref|NP_926568.1|
Sequence length 396
Comment 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Gloeobacter violaceus PCC 7421]
Sequence
MQTLDPVTPALLPLRRVTRPVQVGALTIGGNAPVVVQSMINEDTLDTPGAVAAIRALHKA
GCELVRVTVPSLAHARALERIRKTLEDTYRPVPLVADVHHDGGPIALEVARHVDKVRINP
GLFVFRRARLGDYTAEDVERARAQIREELKPLVDVLGAQDKAMRIGVNHGSLSERMLYIH
GDTPEGMVQSAVEFVEICEQLGYHNLVISLKASRVPVMIAVYRLAAKLLDARGMHYPFHL
GVTEAGDGEYGRIKSTAGIATLLADGIGDTIRVSLTEDPLKEIPVCYGILQALGLRRTMV
EYVACPSCGRTLFNLETVLHRVREATRHLTGLNIAVMGCIVNGPGEMADADYGYVGKTPG
TISLYRGREEIKKVPEARGVEALVDLIKSDGRWVDP
Download sequence
Identical sequences Q7NFA4
gi|37523191|ref|NP_926568.1| 251221.gll3622 NP_926568.1.44878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]