SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37523251|ref|NP_926628.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37523251|ref|NP_926628.1|
Domain Number 1 Region: 127-315
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 2.42e-52
Family ATP-binding domain of peptide synthetases 0.0000389
Further Details:      
 
Domain Number 2 Region: 1-125
Classification Level Classification E-value
Superfamily PreATP-grasp domain 1.47e-33
Family Prokaryotic glutathione synthetase, N-terminal domain 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|37523251|ref|NP_926628.1|
Sequence length 324
Comment glutathione synthetase [Gloeobacter violaceus PCC 7421]
Sequence
MKILFIVDPLETLKPGHDTSVALMQAAARRGHSVWAAEVGDLQVHHHRAAAQVRTLTIHP
GRTPFYTVEAVGFYPLSEADVIWMRKDPPVTSAYLWATQVLDLVNAGRGDGRTTFVLNRP
SGLRNDNEKLYALHFPDLVPETRVCTHRQDILDFVDIHGRAVIKPLDGKGGEGIFLLARA
DRNLNAIIEASTAYGTRHVMVQRYLEESRQGDKRIVLLAGEPIGALLRVPREDDVRGNMA
AGGRVVKTTLTERDREICRVVGPRLVADGHYFVGIDVIGAYLTEINVTSPTGICEIDVLD
GVVLEDEIVDWLVEYTRPALARNL
Download sequence
Identical sequences Q7NF44
251221.gvip498 gi|37523251|ref|NP_926628.1| NP_926628.1.44878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]