SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37523387|ref|NP_926764.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37523387|ref|NP_926764.1|
Domain Number 1 Region: 14-246
Classification Level Classification E-value
Superfamily PLP-binding barrel 4.51e-66
Family Alanine racemase-like, N-terminal domain 0.0000144
Further Details:      
 
Domain Number 2 Region: 240-374
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 1.26e-49
Family Alanine racemase 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|37523387|ref|NP_926764.1|
Sequence length 381
Comment alanine racemase [Gloeobacter violaceus PCC 7421]
Sequence
MDGFDATRRAWVEIDLDALRHNVQQIRQRLRSHCRVMAVVKADAYGHGALSAGRAALEAG
AACLGVATLEEGAQLRESGLGCPIVVLGPIHTGAEVAAVEHWRLEPTLCTPRQVLVCAEH
LSAPHPVHLKIDTGMTRLGAPWQDAVEFVRLAYRLPRLQVASVYSHLATADEPDSAALGE
QHRRFERVLGELEAAGVRPECVHLANSAAALGDPGLHYDLVRVGVALYGLYPAPEFYGAA
ELRPVMQVRARVTQVREVPADTGVSYGHFWRTPTPSRLATVAIGYADGVPRRLSGQLQVL
VHGRRAPQVGAITMDQIVIDCTHLSAVEEGDVVTLLGRDGNEAIGAADWADPLGTIAYEI
LCGFKHRLPRVVRSTAPVFNV
Download sequence
Identical sequences Q7NER0
NP_926764.1.44878 251221.glr3818 gi|37523387|ref|NP_926764.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]