SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37523396|ref|NP_926773.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37523396|ref|NP_926773.1|
Domain Number 1 Region: 1-361
Classification Level Classification E-value
Superfamily Dehydroquinate synthase-like 1.06e-109
Family Iron-containing alcohol dehydrogenase 0.00000000179
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|37523396|ref|NP_926773.1|
Sequence length 384
Comment alcohol dehydrogenase [Gloeobacter violaceus PCC 7421]
Sequence
MKNFTFYNPVKILFGKGQIARLAAEIPVTARILLTYGGGSIKANGVYDQVKAALAGHTVF
EFGGIEPNPHLETLLKAVEVVRAENIDFLLAVGGGSVADGTKFIAAAARFEADPWDILAK
QAPITAAVPLGTVLTLPATGSEMNGTAVVTRAATREKLYFGSPLVMPVFSVLDPETTFSL
PPKQIGNGIVDAFTHVAEQYLTYPVGAPLQDRMAEAILKTLIEEGPKTLANPTDYAARAN
FMWCATMALNGMIGAGVPHDWATHTIGHELTALHGIDHGRTLAIVLPSVLTLKRDSKRAK
LLQYAEWVWGITTGTEEERIDAAIGRTRAFFESVGVPTRLGDYGVPTETIPLIVERLENR
GAVALGEHGDIDPAAVDKVLALSV
Download sequence
Identical sequences Q7NEQ1
NP_926773.1.44878 251221.glr3827 gi|37523396|ref|NP_926773.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]