SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37523535|ref|NP_926912.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37523535|ref|NP_926912.1|
Domain Number 1 Region: 605-639,691-756,1124-1346,1375-1443
Classification Level Classification E-value
Superfamily PFL-like glycyl radical enzymes 8.24e-88
Family R1 subunit of ribonucleotide reductase, C-terminal domain 0.0046
Further Details:      
 
Domain Number 2 Region: 755-880,1050-1122
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 9.03e-43
Family Intein (protein splicing domain) 0.0079
Further Details:      
 
Domain Number 3 Region: 193-332,529-606
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 2.88e-33
Family Intein (protein splicing domain) 0.018
Further Details:      
 
Domain Number 4 Region: 48-185
Classification Level Classification E-value
Superfamily PFL-like glycyl radical enzymes 8.24e-17
Family R1 subunit of ribonucleotide reductase, C-terminal domain 0.01
Further Details:      
 
Domain Number 5 Region: 958-1079
Classification Level Classification E-value
Superfamily Homing endonucleases 1.49e-16
Family Intein endonuclease 0.052
Further Details:      
 
Domain Number 6 Region: 409-498
Classification Level Classification E-value
Superfamily Homing endonucleases 0.00000000000151
Family Intein endonuclease 0.028
Further Details:      
 
Domain Number 7 Region: 317-397
Classification Level Classification E-value
Superfamily Homing endonucleases 0.0000787
Family Group I mobile intron endonuclease 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|37523535|ref|NP_926912.1|
Sequence length 1566
Comment ribonucleotide reductase large subunit [Gloeobacter violaceus PCC 7421]
Sequence
MFVIAQLHLAPLDAELVIRLFAGASTMGMDGVGSLEQGMALSESQRAVLQKYLIGEERTW
EDVCRRVARFVAGAEKTPALQREWQERFFSILAPMKMLPGGSILANSDHGTHGLLNCFVL
SAEDNIQEIAKLVTDAVLTTKFRGGVGINIGAHGQKGYIRPKGTPFADGKALGPCAVLDM
VSETSKKITTGNKCFAAGTLLHTEQGYVPVEQVVAGVGTRVCTHQGFRNISERFDNGEAE
VFRVTTRKGYSVEVTANHKMARLDENGDLLLDELSHLQVGDNLLLLLGSNPVTEKVRLQC
IPAGYRSSIEIAQPPELDEQLAYLLGYAYGDGCVGRGATYNYLSLAVSHTYPNVRDQLAA
IIREKFGLTTKIYSGSGAVWNLLVHSANLLDWLKANGLLKQKAADLAMPEAILRSPSSVV
GAFLSGYFDADGCVRGGKGGYGFDCTSKAFVGAVQLLLLAEGIVSNLHTTDRSRQGWRTI
YRLNVCGTEFKRRFQTLCCRSAKVVHSPMVLGRDGTGGYPPALVRGASYQRVVAVGGKHL
LYTALLKVIEKTRTAGKQALAESLCQHVNYFPDPIVAIESVGTQRVYDIEVEGMHLLSGN
GIYTSNSRRGAFMFSMHWKHPDVWEFIQAKTQSVMDARVARDLIERTADLAVDKGLSDVE
KNARLDQLKQELTDTWTETHLSPKGTRDRRWHNANISVLVDDEFFDKLDEGNPGVVDLWN
QIAQYAHDTADPGLLLSDNARRRSPIKNFITTTNPCVTADTWVHTGDGPRQARDLIGVQH
STYVNGELFSTTSAGFFATGVKPVLRLRTKEGHQLRLTGNHQVLKLTAQTRHRQYTEWVP
AEQLNPGDRVMLHDHRGLQPWDGPGDAETGWLLGTLVGDGCFVRDNNGTLCAKLSFWEAS
APEMPGRAVTLATSRANVGRKLAGTINAQGVASVQSSGLARLAATFKIVPGCKRVTSRVE
QGSFEFYRGFLRGLFDADGSVQGDQQKGVSVRLSQSDLPTLEAVQRMLLRLGIASDIYKR
REAQVRMLPDSRRQSAPYPCKSQYELVIAKDNLQVFAQLVGFEHPAKAARLAKLVDTYSR
TPNRERFSATVESLTPDGIEEVYDCTVPGPARFDANGLVVHNCGEIWLPPNSACNLGSIV
ISKFMHRTERGVELDWEDLARTVEISTRFLDNVLDVAEFATPAQKHNVRNVFRQLGLGIM
GWADWLKARRIPYDSEAHLREIDKVGRFIAERAYRTSEALAAEKGACGIWEEIKDVRPGN
PFERWRDSTGRVLSGDEAAERAEALTQTPRRNSTVLSIAPTGSIAQLASCSWAFEPDFGL
TIWKQVYVDASSSQQNWVQIPSPYVEALGLGEADRQIVLQTGSLQGTAFAAAHPEEAAAF
KISREISWQWHVLAQSRWQNWVDSSISKTINCSRETTVEEIKEMYRFAQRNGLKGITVYR
EGTLESEPVKIGAIDQNEPAAAAQPVAPTADGNGNGYVPARPFATGAARPAMLDEEVSQA
ASLIGIHYDEGPMYLSEEAPVDDWTSSQFKGGCGGGVLHYQVWIRENGRRLLVVRSDSYS
MCFVKS
Download sequence
Identical sequences Q7NEB4
gi|37523535|ref|NP_926912.1| 251221.gll3966 NP_926912.1.44878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]