SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37523557|ref|NP_926934.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37523557|ref|NP_926934.1|
Domain Number 1 Region: 299-498
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 2.09e-50
Family Multidrug efflux transporter AcrB transmembrane domain 0.00000371
Further Details:      
 
Domain Number 2 Region: 804-1028
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 4.45e-47
Family Multidrug efflux transporter AcrB transmembrane domain 0.00000453
Further Details:      
 
Domain Number 3 Region: 565-669
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 5.49e-30
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.00023
Further Details:      
 
Domain Number 4 Region: 139-183,276-332
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 1.67e-27
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0011
Further Details:      
 
Domain Number 5 Region: 39-131
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 5.49e-27
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.00012
Further Details:      
 
Domain Number 6 Region: 720-803
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 2.62e-21
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.00051
Further Details:      
 
Domain Number 7 Region: 184-274
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 3.01e-20
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|37523557|ref|NP_926934.1|
Sequence length 1050
Comment RND multidrug efflux transporter [Gloeobacter violaceus PCC 7421]
Sequence
MFVDFFIRRPIFAGVCAVIILLAGLVSIPSLPIAQYPEISPPQVTVTATYVGASAEVVEE
TVTTLLERQINGVEGMRYITSNSSDQGVSTIVVTFELERDKDIAAVDVQNRISTVLPQLP
SLVQQTGVQISKQSGAPLLGIGLYSEKGQYTNDLLSNYADLYLVDALKRVPGVGNVQIFG
ERRYSMRLWLDPNRLAARSLTAQDVVNAVNEQNVQVGAGSIGQPPLDKSQTFQIGLRVLG
RLKEPGEFADLVIRTNADGSLTRLKDVGRAELGAENYNSFLRFRGQDGVGLGIYPIPGSN
ALDIGKAVKARMAELEKSFPPGVQYRVAFDTTDFIEESAAEVIETLIIAILLVVLVMFIF
LQDWKSTLIPAITIPVSLVGTFIFVKLFDFSINSLTLFGLTLATGLVVDDAIVVIENIAR
TSKEQCKDPKECASDAMREVTAAVIAIALVLMAVFVPVAFFPGTTGQLYKQFALTIVFSI
VISTFNALTLTPALAALLSTGQVGESRFFLFRWFNSGFEAFKNGYLRVLEILTRFKTVVV
LVFIGLLGLTAWLFVKVPTAFLPEEDQGYFITLVQAPQGVSINYTSDVMRQVEKILLAQE
EVEGTFAIGGFGFSGSAANSGVIFTTLKPWSERHKPEEQMLPFINRVRGPLLGIKEALVI
PFNAPTIQGLSAFGGFAFELQDRGNNGIEALSATAQELIAKGNATPGLQGLFTTFNPNSP
QIVIEVDRNKAKSLNVPLSEIFNTLQTYLGSRYVNDFNLFGRTYRVYVQADEKFRANPRD
IRALYVRSTSGRMVSMGELVSTEPVTAPSIVTHYNLFRNVEITGNAAPGFSSGQAIAAME
KLAAETLPASMGFEWSGISLEEKVSGGLAPFIFALGILFVYLVLAAQYESLVEPFIILLA
VPLAVLGALLALSFRGIANDVYCQIGLVMLIGLASKNSILIVEFANQARERGMSIVDAAL
EASRERLRPILMTSFAFILGIWPLVIASGAGAASRQSLGTAVFGGMIISTFLSLFVVPIL
YIVLVSIRERFVGGKGEPAAVPAKNEVPAE
Download sequence
Identical sequences Q7NE92
NP_926934.1.44878 251221.glr3988 gi|37523557|ref|NP_926934.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]