SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37523599|ref|NP_926976.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37523599|ref|NP_926976.1|
Domain Number 1 Region: 88-148
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 0.0000759
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.012
Further Details:      
 
Weak hits

Sequence:  gi|37523599|ref|NP_926976.1|
Domain Number - Region: 146-209
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 0.0486
Family Enolase N-terminal domain-like 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|37523599|ref|NP_926976.1|
Sequence length 223
Comment hypothetical protein glr4030 [Gloeobacter violaceus PCC 7421]
Sequence
MNFQSDRPIPGIRTTLGLPLPRKRWLPLPTPVEVIWALVGLVLTVGGTLCRVQLPDRFPQ
SIAFGSWPPAVEWYFEPGYPFSLQIAAVLFSGCVGGPVAAALAQMAYLALGFSGFPVFTG
GGGIGYFTQPQSGYLLAFVPAAALTGVLAFRCRSNLNWLAASALAGLAIVHIGGLAGLLV
HLPVGPTLAQAVVQFSLLPLLGQAIGVLLAAGAGWLVRRLLLS
Download sequence
Identical sequences Q7NE50
251221.glr4030 gi|37523599|ref|NP_926976.1| NP_926976.1.44878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]