SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37523639|ref|NP_927016.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37523639|ref|NP_927016.1|
Domain Number 1 Region: 66-344
Classification Level Classification E-value
Superfamily PLP-binding barrel 2.43e-66
Family Alanine racemase-like, N-terminal domain 0.0036
Further Details:      
 
Domain Number 2 Region: 448-557
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 0.0000663
Family Eukaryotic ODC-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|37523639|ref|NP_927016.1|
Sequence length 644
Comment arginine decarboxylase [Gloeobacter violaceus PCC 7421]
Sequence
MQDWTIEDSAELYQIHGWGEPYFKINDKGHVAVMPRGEGNGEIDLFHLVQDIQKRGLNMP
MLIRFSDILADRIARLNACFVEAIREYDYPGIYKGVYPVKVNQQRHVVEEVVEFGRPFQY
GLEAGSKPELLIALATLKTPGALIICNGYKDSEYIETALLAQRLGHTPFVVIERFHELTL
LIEAAQKLGIRPLIGVRAKLTARGIGRWGDSTGDRAKFGLSAGEIMEVVAQLKAADLLSS
LQLLHFHIGSQISAINVIKTALREASCVYVELAQMGAPMQYCDVGGGLAIDYDGSKTNFR
ASKNYNMQEYAYDVVAAFQDACRTKNVPVPTLVSESGRAITSHQSVLVFDVMGVSHLQFG
EPEPPARNEHSIIRNLYETYTQITPDNVQEAFNDASQFKEEALSLFALGYLGLGERARAE
RLYWGCCEKILNLVRELDYIPDELADLEKNMASTYYCNFSVFQSAPDSWAIDQLFPIMPI
HRLDEEPKARGTLADLTCDSDGKIDQFIDLRDVKGVLELHPVRPEEPYYLGMFLNGAYQE
ILGDMHNLFGDTNTVHIHLASDEPGEQSYRLEHVVKGDTMTEVLKYVQYDHEAMLESIRR
ETEQALRERRITLSESRLLLQHYERSLSGYTYLTNELQVELAAR
Download sequence
Identical sequences Q7NE10
gi|37523639|ref|NP_927016.1| 251221.gll4070 NP_927016.1.44878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]