SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37523818|ref|NP_927195.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37523818|ref|NP_927195.1|
Domain Number 1 Region: 121-234
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 2.09e-33
Family Pentapeptide repeats 0.00068
Further Details:      
 
Domain Number 2 Region: 6-65
Classification Level Classification E-value
Superfamily Chaperone J-domain 0.0000000000000144
Family Chaperone J-domain 0.0019
Further Details:      
 
Domain Number 3 Region: 109-118
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00000915
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|37523818|ref|NP_927195.1|
Sequence length 241
Comment hypothetical protein gll4249 [Gloeobacter violaceus PCC 7421]
Sequence
MDELERSYWVLGLESGASPEEVSQAYKDLVFVWHPDRVPTENTRLHQKAVEKLKEINRAY
EHLRSHRPSPRKVHQAHQTQPASNFRPVYRPSASATPANAYRPRPAPPPPPPPPPPPPPS
RPDMSGADLRGANLKEKDFEGRNLSNANLSGADLSDAFLHKINLSGADLSGANLFRANLL
RANLRGANLQDAHLIGADFSGADLSGANLRGAQMSAAGRLMVKLTAAILTGAVMPDGQVH
A
Download sequence
Identical sequences Q7NDI6
gi|37523818|ref|NP_927195.1| 251221.gll4249 NP_927195.1.44878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]