SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37523909|ref|NP_927286.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37523909|ref|NP_927286.1|
Domain Number 1 Region: 16-170
Classification Level Classification E-value
Superfamily Probable bacterial effector-binding domain 2.25e-20
Family SOUL heme-binding protein 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|37523909|ref|NP_927286.1|
Sequence length 174
Comment hypothetical protein glr4340 [Gloeobacter violaceus PCC 7421]
Sequence
MAELPEGFPAPTLPGVIEIKHYPPYRSATVRIEGALAGATSAAFAPLFAHISTNEIAMTS
PVEARYPAIALDEPREHGQAEVSFLYGSLAIAPGRTAQGVAVEDHPAMTVLSLGLRGEYS
WERFRAGLQQLREWLMHHPGYEVSGSARRLLYDSPYVPAERKRSEVQLPVRPEG
Download sequence
Identical sequences Q7ND96
251221.glr4340 gi|37523909|ref|NP_927286.1| NP_927286.1.44878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]