SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37523992|ref|NP_927369.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37523992|ref|NP_927369.1|
Domain Number 1 Region: 34-78,278-517
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.7e-54
Family Bacterial dinuclear zinc exopeptidases 0.0056
Further Details:      
 
Domain Number 2 Region: 126-204
Classification Level Classification E-value
Superfamily PA domain 0.000000000126
Family PA domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|37523992|ref|NP_927369.1|
Sequence length 554
Comment hypothetical protein gll4423 [Gloeobacter violaceus PCC 7421]
Sequence
MLPIRRLLACTALICATALGPAASAQTDNAAGSGKDWWSHVRFLADDRLEGRNTGSESYL
QAARYVAEQFKRAGALPAGSEGYLQPVKFQSRVLDEGRSSLTLMRGGTFEALAIGDDAVI
GVRNGIAPNLEAPLVFAGYGLTVPENNYDDLAGLDLQGKIAVVLSGGPAAIPGALRSHYG
SVAERWKFLKQAGAVGLITVQNPRIMDIPWERSKLLRFFPSMVLAESALQDAPDLVLTVG
MNPASMDKLLAGSGVTFAQILAAADTEKPLPKFAIPAVLKAQVSVKSDTLTSANVAAMLP
GSDPKLKNEYIVLSAHLDHLGIGEPIGGDRIYNGAMDNAAGVATLIDVAAGMRAQNLKLK
RSVVFLAVCGEEKGLLGSKFFANRPTMRPLVANFNMDMFLPIHPLTRLTALGLEESNLAQ
PLRESAGQVGVTVISDPEPNRNSFVRSDQYSFIRTGVPALAFKFGYEKGSAEEKLQKAWL
TTRYHAPSDDINQPVDLEAAAKFNRIIEGLLVRVANQSERPEWNAASFFKRFALTAPGGT
PNPAASSRTGANAP
Download sequence
Identical sequences Q7ND13
NP_927369.1.44878 251221.gll4423 gi|37523992|ref|NP_927369.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]