SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37521417|ref|NP_924794.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37521417|ref|NP_924794.1|
Domain Number 1 Region: 140-338
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 1.14e-52
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0000105
Further Details:      
 
Domain Number 2 Region: 425-555
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 1.44e-34
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00003
Further Details:      
 
Domain Number 3 Region: 3-139
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 8.01e-30
Family Duplicated SiR/NiR-like domains 1 and 3 0.012
Further Details:      
 
Domain Number 4 Region: 340-417
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 0.00000000000000146
Family Duplicated SiR/NiR-like domains 1 and 3 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|37521417|ref|NP_924794.1|
Sequence length 560
Comment sulfite reductase subunit beta [Gloeobacter violaceus PCC 7421]
Sequence
MTDTMRRSKVEQIKENSHNLRGRLREELQQPETTHFAEESVQLLKFHGIYQQDDRDERKA
RKDAGLEPDYAFMVRTKNPGGYAPAAFYLAMDRLADALGSGTLRVTTRQGLQLHGIRKHN
LREAIATISTQLGSTLGACGDINRNVMAPPAPFTARPYAVAREAAAAIADMLTPHTGAYF
EVWQDEALVYSGEPEVEPIYGETYLPRKFKIAVAVEGDNSVDIYTQDLGVIPVFEDGERL
LGYNLTVGGGLGMTHAKPETFPRQADHLGFVSSEDMLEAVKAVVLVQRDHGDRYNRRHAR
LKYLIHDRGLGWFRAQVETYLGKPLQPWRTVAPWVFHDYLGWQPQGDGRYCLGIWIENGR
IKDEGAFRLKSALREIVERFEVDLILTPTQNALLVDVAPEVRAPIDAILQSAGVRPVQAV
SNAERYAMACPAWPTCGLALTESERALPGIIAELEAKLTELDLAQEQISIRMTGCPNGCA
RPYMGEIGFVGSAPGAYNLYLGGNLASTRLNWVFRERVKREDILAVLGPLFSYFKRERAP
GESFGDFCLRKGRADLEAHL
Download sequence
Identical sequences Q7NJI4
251221.gvip254 gi|37521417|ref|NP_924794.1| NP_924794.1.44878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]