SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37521423|ref|NP_924800.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37521423|ref|NP_924800.1|
Domain Number 1 Region: 19-203
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 3.92e-58
Family Methylesterase CheB, C-terminal domain 0.00014
Further Details:      
 
Domain Number 2 Region: 288-475
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 2.74e-50
Family Chemotaxis receptor methyltransferase CheR, C-terminal domain 0.00034
Further Details:      
 
Domain Number 3 Region: 1060-1231
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 6.68e-46
Family Histidine kinase 0.00099
Further Details:      
 
Domain Number 4 Region: 993-1072
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 2.16e-19
Family Homodimeric domain of signal transducing histidine kinase 0.0016
Further Details:      
 
Domain Number 5 Region: 225-289
Classification Level Classification E-value
Superfamily Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.000000000000876
Family Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.013
Further Details:      
 
Domain Number 6 Region: 846-938
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000571
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.078
Further Details:      
 
Domain Number 7 Region: 728-847
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000112
Family Flavin-binding PAS domain 0.055
Further Details:      
 
Weak hits

Sequence:  gi|37521423|ref|NP_924800.1|
Domain Number - Region: 566-631
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0838
Family Flavin-binding PAS domain 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|37521423|ref|NP_924800.1|
Sequence length 1241
Comment two-component sensor histidine kinase [Gloeobacter violaceus PCC 7421]
Sequence
MAIDSGGGADSFSLSLGSFAIVAVGASAGGLEAFTQFLGALPTDTGMAFVLIQHLKADQP
SLLVEILDKTTGMDVVQVHNGTVVEPNHVYVIPPDRQMAITSGVLTLSQRRKTDGQFMPI
DSFFHSLAADWGNRAIGVVLSGADGDGAQGLKAIKAAGGLAFAQDEQSARFPSMPHNAAA
TGLLDFVLPPREIAVRLAAVGRHPYIAPPAATAPPTPPGAEEARSAAIALLRAATGVDFG
QYKRPTFERRLQRRMALHQIESPQEFVRHLQDHPEEVQALYRDVLISVTGFFRDPEAFEA
VKNTVLSAITQQRAEGLPIRVWVPGCATGEEVYSLAIGVLEFLEEHPSPTPVQFFGTDIS
EEAIALARTGLYHASQIEGLSPERLRRFFSQGEGGHRVCKRVRELCVFARHDLLADPPFS
QMDLVSCRNVLIYFSLPAQKRVLTTFHYSLKPDGFLLLGTSESPGGASELFNRVDSKNKL
FSRKAVPARLLLEYAAGPVAADPLNPKQPAAGGAGNAPDLQKEADRLVLDRYAPVGVVVG
ADAEVLHFRGQTGPYLQPSPGRASLNLLKMVHPGLRSQLRSALQLAAKQSLAQCQQDIRL
YDGDRERRVRIDVAPFRSASGQTHFLVLFADTPMVEVSAPLPGPRSAAADRQSAQQQRLL
ELQQELTAKEEYLRTAIEESEAVNQNLRVANEEILSSNEELQSTNEELQTAKEEIQSTNE
ELHTINDELQRRNRELDRLGNDLQNLLASTRLPIVMLDSELRIRRFTPQAGELLHFVSAD
VGRPVRDINHRLSVPDLPERVLEVIASRRIHIQEVQDRGGHWHELCIRPYHTLDGATEGA
VLVLVDIDQSKRAVEEVKAARDYAEAIVETVGEPLIVLDAELSAVTANRAFYELFETHPD
QIEGRSLFEVSGGQWNLPQLREALEGVLQGDGRVQDFEVDRDFERLGRKILLLNARHMPF
YAGGPRQILLSVSDVTARRLLEGERSELLAQSEAARRDAEAANRSKDEFLATLSHELRTP
LNPIIGFSQLLRRGKCDPAQTAQALEVIERCGKLQAQLIDDMLDISRIISGKLHVVMRRI
DLVPVVGAAVEAVDAIGRAKSIRIETVCAPAPPVMADSTRMQQVVWNLLTNAVKFTPEGG
RVGVRLEGTAAGVRLTVSDTGMGIAPEFLPKMFDRFAQGDGSRTRTQGGLGLGLYLVRSL
IELHGGTVDAHSAGEGRGSVFTVALPAAPPQPEHPDRNLGS
Download sequence
Identical sequences Q7NJH8
NP_924800.1.44878 251221.gll1854 gi|37521423|ref|NP_924800.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]