SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37521788|ref|NP_925165.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37521788|ref|NP_925165.1|
Domain Number 1 Region: 6-380
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.92e-62
Family Pyridoxal-dependent decarboxylase 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|37521788|ref|NP_925165.1|
Sequence length 382
Comment histidine decarboxylase [Gloeobacter violaceus PCC 7421]
Sequence
MSTAGIRASVADELVTYGLSLDIHKRNHLGYPFCLKYDHAEQLAETIQDQRYTLINIGDP
FSSPIYQISSLEYERQVLGFFAELFGLDRQPRPWWGYIGSCGTEGNLYGLLLGRLAQPEG
ILYFSEAAHYSVGKAARMFRMPYRKVRSQASGEMDYAHLAEIVESGQPVIINLTLGTTFT
GAVDEIGRTVEALTGRGIGLDQVYIHVDAALGGMIACYIRPELISFDWPIGSLAISGHKF
IGCPHPCGVVLTYKETADRFSSEISAEVEYIGSTDLTIMGSRNGHTPLYLWAEIQRRKST
FHLEAEAIVDKARFLHQKLSDQGLPALLNPLSSTVVFPRPPQPVIAKYQLAVQVDQAHAV
IMQQHSYELLEEFAGVLGTCLG
Download sequence
Identical sequences Q7NIG4
gi|37521788|ref|NP_925165.1| NP_925165.1.44878 251221.gll2219

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]