SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37521889|ref|NP_925266.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37521889|ref|NP_925266.1|
Domain Number 1 Region: 4-367
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.08e-101
Family Cystathionine synthase-like 0.00000523
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|37521889|ref|NP_925266.1|
Sequence length 385
Comment small subunit of soluble hydrogenase [Gloeobacter violaceus PCC 7421]
Sequence
MDDKLFLMIPGPTPMPERALLAMAKAPIGHRSGEFAKIMAEVSENLKWLHQTASEVLMLS
SSGTGALEAAIINACSPGDRVLVGANGKFGERWVEVAQAFGLDVEVIFAPYGQPLSTDAF
KAALEADTDKTIKAVVVTHSESSTGVINDLETIVGYIRAHGEALSIVDAVTSLGATSVPV
DAWGLDFVGSGSQKAYMIPPGLGFLAVSERGWAACERSTMPRYYFDLRKYRKALKKNNTP
FTTPVNLVFALQTTLQMLRAEGLDALFARHARLRDATRAALRALGLALFNPDDHSASPAI
TAVVPPEGIACDKLRATLKKHYDIVIAGGQGEMEGQIVRIGHLGFVGERDVLTAIAALEG
ALRTLGYDGFTPGSGVAAASAVLFG
Download sequence
Identical sequences Q7NI63
NP_925266.1.44878 gi|37521889|ref|NP_925266.1| 251221.gll2320

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]