SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37522685|ref|NP_926062.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37522685|ref|NP_926062.1|
Domain Number 1 Region: 8-388
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.26e-104
Family AAT-like 0.0000212
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|37522685|ref|NP_926062.1|
Sequence length 392
Comment aminotransferase [Gloeobacter violaceus PCC 7421]
Sequence
MVPPVKHRLSERALAVVPSLIRDASRYCDELGALNLAQGLPDFAAPAFLKEAAQRAIAAD
RNQYCDPWGLAQLREAIAAKCTRDNALAVDPATQVTVCCGATEGINLALMALLDPGDEVV
VFSPFYENYRPNLATVEAKPRYVPLSAPDWRVDEAVLERAFAGTAPRAVIVNNPANPTGK
VWSRQELELVARYCERHDAYAITDEIYEYILYDGAEHISLASLAGMAERTVTVSGLSKTF
CVTGWRLGYVIASEPLTAAIRRLHDFLTICAPAPMQHAAVAALEAPADYYADLRRLYQAK
RDRLVTALYRSGFEPVRPAGAYYVWTDAGVLGAKNALAAAGRLAVEAGIAAVPGDCFLPP
GHPNCNLRFCYAKSDETLAAAVERLDRWSGHG
Download sequence
Identical sequences Q7NGQ2
NP_926062.1.44878 gi|37522685|ref|NP_926062.1| 251221.gll3116

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]