SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37523131|ref|NP_926508.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37523131|ref|NP_926508.1|
Domain Number 1 Region: 17-201
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 4.84e-57
Family Methylesterase CheB, C-terminal domain 0.0001
Further Details:      
 
Domain Number 2 Region: 282-475
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 1.03e-48
Family Chemotaxis receptor methyltransferase CheR, C-terminal domain 0.0004
Further Details:      
 
Domain Number 3 Region: 1056-1219
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 2.23e-40
Family Histidine kinase 0.00076
Further Details:      
 
Domain Number 4 Region: 207-284
Classification Level Classification E-value
Superfamily Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.0000000000000863
Family Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.012
Further Details:      
 
Domain Number 5 Region: 985-1065
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.00000000000018
Family Homodimeric domain of signal transducing histidine kinase 0.0044
Further Details:      
 
Domain Number 6 Region: 848-976
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000723
Family Heme-binding PAS domain 0.044
Further Details:      
 
Domain Number 7 Region: 729-848
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000933
Family Flavin-binding PAS domain 0.05
Further Details:      
 
Weak hits

Sequence:  gi|37523131|ref|NP_926508.1|
Domain Number - Region: 663-732
Classification Level Classification E-value
Superfamily Tropomyosin 0.0203
Family Tropomyosin 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|37523131|ref|NP_926508.1|
Sequence length 1225
Comment two-component sensor histidine kinase [Gloeobacter violaceus PCC 7421]
Sequence
MDVGREPEQQQPGDLDLFAVVGIGASAGGLEAFTQLLSHLPNHTGMAFVLVQHLDPSHRS
LLAELLSRTTQLPVVEVHDGMTLEADRVYVIPPNTQMTLARGALQLAPREKVQGRYMPID
AFFRSLAQERGSRAIGVVLSGSDGDGALGLEAIKAAGGITFAQCEASAQFSDMPHRAAAT
GVDFILPPQAIAEELVKISAHPYVIPARSNMPADEEALPSVFALLQAATGADFTYYKRTT
LLRRLRRRMVLHKLERLVDYVRHLQDNPGEVQTLYEEILISVTSFFRDPDVFAALQEKVF
AGICQGKAAGSPIRVWVPGCATGEEVYSIAITLLEWLGPQAHETPIQIFGTDISEAAVEK
ARLGIYKEEAVANVSPGRLRQFFVQVAAGYQIGKSVRELCVFARQNLSSDPPFSNMDLIS
CRNVLIYLEPTLQKRVLPIFHYSLKPTGFLVLGSSESTGEFTDLFAVVDKKHKIYTRTAA
PSRLSFDFVTGDYRLARARRGGLTGEATWAGLNIQQQADRIVLNRYAPAGVLTNDRLEIL
QFRGETGAYLRPAPGEPSFNLLKMARPGLLPELHTAIYQAKSQEGAVEKAGLRVEGNDGP
RHIRIVVIAFKVPPADERYFLVLFETMDPVMPAAPEARHRHDSDQRIDPEPEISRLRQEL
TIVRQELVHTQAYLQSIIEEQEATNQSLTTANEEILSSNEELQSTNEELQTAKEEIQSAN
EELRTTNEELQSRNLEARQVNNDLLNLLSNVNIPILMLTNDLRIRRFTPAAQRLFNLIAT
DVGRSLSDIRLNFHAPDLEESLLEVIDTLSPKEREVQDLEGYWYLLRIRPYRTVDHQIDG
VVLALVDIDALKNSAQLLEAARIYAESIVETVRGPLLVLDSDLRVRTANRAFYQTFQTVP
AQTEGQRLFELAGGQWDIPRLRLMLENLLLHNAQLLDYEVEHDFENVGRRVMLLNAQEIL
APEQDRLILLALEDITEQKRTQQSQQMALQKEYELNELKSRLIAMTSHEFRTPLSTIILS
TQLLSSDSPHQSAQKRLKQQQRIERAIEQMTDLLDGILSIGQAEIDQVQIRRVPLDLESF
CRQLVEEMQAAPGGAHRPAFESAGQCRGANLDAVMLRQILSNLLTNALKYSAPDSTVRLQ
LACRDGQAVFTVVDEGIGIAVEDQERLFEPFYRGRNVANIPGSGLGLAIVRRLVELLKGR
LAFESRPQQGTTFTVALPLEEPADD
Download sequence
Identical sequences Q7NFG3
251221.glr3562 NP_926508.1.44878 gi|37523131|ref|NP_926508.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]