SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37523274|ref|NP_926651.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37523274|ref|NP_926651.1|
Domain Number 1 Region: 152-318
Classification Level Classification E-value
Superfamily Chondroitin AC/alginate lyase 0.00000011
Family Alginate lyase A1-III 0.032
Further Details:      
 
Domain Number 2 Region: 408-498
Classification Level Classification E-value
Superfamily PKD domain 0.0000373
Family PKD domain 0.011
Further Details:      
 
Weak hits

Sequence:  gi|37523274|ref|NP_926651.1|
Domain Number - Region: 750-863
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000435
Family Beta-D-xylosidase C-terminal domain-like 0.041
Further Details:      
 
Domain Number - Region: 594-684
Classification Level Classification E-value
Superfamily PKD domain 0.0216
Family PKD domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|37523274|ref|NP_926651.1|
Sequence length 868
Comment hypothetical protein gll3705 [Gloeobacter violaceus PCC 7421]
Sequence
MPTFQPRAGRLAAGGFIVLVLSFFLVSPAAAARNWWVFLSPTEAELLYKAASFSAIKSEV
DNDYLNGLSEPKTCLDTRSPWVQQMAAAQEMLSATYLALKWGKYGGADNSELDAYRERIA
DNWKAILEAGPIDLWQDNFDGVTRQFVAGGCDYTQSYQPGWYEGDIALRFWIFGALPSYD
AVRDELSTSEREAIDTWLRGLADQLWSGRDFGREHNRGASAVAQAHVIALVLQDRSRFES
YYSHASGGLKDYYRQMNYAPLAGCDFPERPGLTSELASRDGIHGVQTVMHSFGALAVIAH
AGHMGGNVDWNIYNTTRDPNLLAGVLGTWYDIEEALRDEFNSYIVCLENETDASESFEDT
SLDERVWAPLAFFQTRFQNVDSWGLGNLRALRKERASLHAQNRLANQKPTVELTAPASGA
KLTAPATVTLNAEARDNNGTVSKVEFFRDSTKIGEDLASPYSATWKLAEAGTYALKAKVT
DSQGVTADSTSRTITVSQPSGLSVYLVQPLDGAFVAGGSDAKLQAVAAHSSDSISKVEFY
QGSTKLGSDSASPYFYTWVKPPSGSYSLTAKAISSTGATITSSAIDLSVGSPNTAPTANM
VDPEDGAQLTAPATVSLHAEADDSDGTISQVEFFSGGVKLGQDTTSPYYFSWKGMAAGKY
SIAAVATDNRGAVFTSAAVGVTVSLPTPWQLKDIGNVGLTGNAAFNPDSDTFTIKAAGAD
IWGDADGFMYVYQPISGDGQLVARVSSLGNTDSWAKAGIMIRDGFTSSARNVFVGLTPSK
GITFQYRTKTGGDSGSKTVAGYKAPYWLKLVRTGDTIKGYYSSNGGSWVWIGTQSIPMAT
DLFMGLAVTSHDSAELTTAAFTDVSASK
Download sequence
Identical sequences Q7NF22
gi|37523274|ref|NP_926651.1| 251221.gll3705 NP_926651.1.44878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]