SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37523677|ref|NP_927054.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37523677|ref|NP_927054.1|
Domain Number 1 Region: 2-385
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.29e-109
Family AAT-like 0.0000684
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|37523677|ref|NP_927054.1|
Sequence length 392
Comment LL-diaminopimelate aminotransferase [Gloeobacter violaceus PCC 7421]
Sequence
MKTAARLDRIPPYLFAEIDRRRDEAVARGVDIINMGIGDPDKPTPPVVLEAMHAAIDDPS
THNYPPYKGTKAYREAAAAWFERRFGVGGFHPDTEVISSIGSKEAIHNTFLAFVDPGDYT
LIPDPAYPVYRTSTIFAGGEFFAMPLLPENQLLPDLEAVPETVARKAKLLWLNYPNNPTG
AVASLEFFEKVVHFAKKHDILVCHDNAYSEMAYDGYKPPSILQVPGARDVAIEFLSCSKA
YNMTGWRVGFVIGNRTGIAGLGQVKTNIDSGVFKAIQQAAIAAFGLDDERLHALMAVYQN
RRNIIVEGLRSLGWPLEAPKATLYVWAPIPKSFGSSVEFVGALLDKCGIIVPPGNGYGEH
GEGFFRIALTVPDERMREAIGRMEAAGIRFEG
Download sequence
Identical sequences Q7NDX4
NP_927054.1.44878 gi|37523677|ref|NP_927054.1| 251221.glr4108

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]