SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|37523984|ref|NP_927361.1| from Gloeobacter violaceus PCC 7421

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|37523984|ref|NP_927361.1|
Domain Number 1 Region: 38-309
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 1.71e-75
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.000000148
Further Details:      
 
Domain Number 2 Region: 299-400
Classification Level Classification E-value
Superfamily Alpha-L RNA-binding motif 0.00000000000000262
Family Tyrosyl-tRNA synthetase (TyrRS), C-terminal domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|37523984|ref|NP_927361.1|
Sequence length 402
Comment tyrosyl-tRNA synthetase [Gloeobacter violaceus PCC 7421]
Sequence
MDERQVERLSGHGVAEIFPGGAEALTRRLADAETARMPLRVKLGIDPTRPDLHLGHTVVL
RKLREFQDLGHTAILLIGGFTAQIGDPTGKSEARPRLSAAEVEEYAETYLDQARLILNFD
TLEVRNNTEWLSGLDLAAIIKLLASTSVAQMLAKEDFGQRYEAGTAIYLHEFLYPLMQGY
DSVALDADIELGGTDQRFNLLMGRNLQELFGKKPQLALTVPLLVGLDGVKKMSKSLDNYV
GVTEDPLTMYSKLEKTPDALVETYFELLTDLSVSALSANPRERQKRLALAVTGWLHSPEQ
ALRAQEAAAAMVTGSGGTGADLEAVPEFSLTEIAFPVRLANLLKAAGLCPTVSEGMRQIK
NGAVRLNQERITDPNCGFAEAAELTGAVLQVGKKHFRRLVPS
Download sequence
Identical sequences Q7ND21
251221.gvip571 gi|37523984|ref|NP_927361.1| NP_927361.1.44878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]