SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0240580 from Drosophila willistoni 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0240580
Domain Number 1 Region: 6-254
Classification Level Classification E-value
Superfamily CutC-like 4.58e-58
Family CutC-like 0.0000137
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0240580   Gene: FBgn0213448   Transcript: FBtr0242088
Sequence length 260
Comment type=protein; loc=scf2_1100000004902:complement(2090915..2091697); ID=FBpp0240580; name=DwilGK11437-PA; parent=FBgn0213448,FBtr0242088; dbxref=FlyBase:FBpp0240580,FlyBase_Annotation_IDs:GK11437-PA,GB_protein:EDW80681,REFSEQ:XP_002069695,FlyMine:FBpp0240580; MD5=9808f77cfaa8aa3589f13759fe7a75e5; length=260; release=r1.3; species=Dwil;
Sequence
MSGHDIKLEVCVDSIKSAFAAEAGGASRIELCSALGEGGLTPTVGTLKTLKELSFNLPIF
CMLRPRRGTDFVYSDEELHAVLTDMSMLRENGADGFVFGALNPDRSIDAEKCRMVLSKAE
GLPVTFHRAFDLTDPKRMHENVELLKELGFKRLLSSGFRPTAGEGVECLAQLIAKHHRDI
IVIPGAGVKVTNLEEILTVSRCREFHASAMETASEDYSVSTTSRMECDVTMGKQDIDPYY
GTCQNVVRKMVTIATAMSSR
Download sequence
Identical sequences B4NA38
7260.FBpp0240580 FBpp0240580 XP_002069695.1.14588

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]