SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0249955 from Drosophila willistoni 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0249955
Domain Number 1 Region: 472-601
Classification Level Classification E-value
Superfamily Plus3-like 1.02e-41
Family Plus3 0.00000503
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0249955   Gene: FBgn0222808   Transcript: FBtr0251463
Sequence length 831
Comment type=protein; loc=scf2_1100000004510:complement(113582..113688,113759..115000,115064..116129,116245..116325); ID=FBpp0249955; name=DwilGK20812-PA; parent=FBgn0222808,FBtr0251463; dbxref=FlyBase:FBpp0249955,FlyBase_Annotation_IDs:GK20812-PA,GB_protein:EDW72257,REFSEQ:XP_002061271,FlyMine:FBpp0249955; MD5=ac9dbad6a3cc338524dfec3629704329; length=831; release=r1.3; species=Dwil;
Sequence
MGKRRTQSLIDSNSSDSDSESDTNLESDLMSLAKKRKKPQNANKASSKSDSDSDWANNKA
GGPATKKKKRQKKASRDSSSSESNWDDDSQDEVQPQAPPAAPSTSTAVPEVGGAQRGESE
QEEGEVSDSDSDANDQKSDKSNSSSGSDSDSSSNSSSSSSSSDSEFDDGFDDDLMGDEED
RKRLNGLSEKERETEIFKRIEQRDIMRTRWEIERKLKLARRGEKEKIEKSKKSKGDRAKN
KLKKKQKKEKKAKKASEMQEAAAAANSQTIPSASSALATSTNELDARSALENKRQSPILS
RGGDANDALPSTSGGMTTSPAMGPPNDRDSEEAASSAGVNDYFDHKERSKERKKNVEANK
TDDKRSNAMAMLKAKREGKAKREEEEAAKRQAERERDDDKEELENVSGCKSAVKLKASEI
YSDDSGSSDWDDDEAKPSGKRSRSISSKASSESDDDDDAQEKKAKSPVFITTREDLNKLR
LSRHKMERFVNLPIFEATVMNCFVRISIGNNDQKAVYRVAEIVGVVETGKIYTLGTTRTN
RGLRLKHGTSERVFRLEFISNQEFTESEFNKWSEVCQQSHVQMPTIDLIEIKQGDIRKAL
NYEYKDEDVDKIVEEKNRFRNRPTNYAMRKTCLMKERDAAMLRGEYNLAQDLGTQIDQLE
SRASELDKRRSHTLNLISYINDRNRKRNVEDAEKAIMEEARANKGQKISDPFTRRITQPR
MGFKGGKKDEEDGVQMAALPPPPTNKKRPGANEAGSSSSSSAGNSHSSSGSKSADGKDYS
LYSLHDFDIDLDVPLPVSSSNAVPKPASKPAETVSKRSLNLEDYKKKRGLI
Download sequence
Identical sequences B4MJG8
FBpp0249955 7260.FBpp0249955 XP_002061271.1.14588

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]