SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0251717 from Drosophila willistoni 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0251717
Domain Number 1 Region: 322-379
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 6.54e-22
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.00015
Further Details:      
 
Domain Number 2 Region: 6-49
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 0.00000000000000654
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.00048
Further Details:      
 
Domain Number 3 Region: 224-324
Classification Level Classification E-value
Superfamily ARM repeat 0.0000535
Family GUN4-associated domain 0.076
Further Details:      
 
Weak hits

Sequence:  FBpp0251717
Domain Number - Region: 132-212
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.000392
Family beta-sandwich domain of Sec23/24 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0251717   Gene: FBgn0224551   Transcript: FBtr0253225
Sequence length 379
Comment type=protein; loc=scf2_1100000004921:complement(356039..356146,356215..356459,356525..356732,356803..357065,357102..357180,357259..357267,357529..357732,358500..358523); ID=FBpp0251717; name=DwilGK22574-PA; parent=FBgn0224551,FBtr0253225; dbxref=FlyBase:FBpp0251717,FlyBase_Annotation_IDs:GK22574-PA,GB_protein:EDW82944,REFSEQ:XP_002071958,FlyMine:FBpp0251717; MD5=403085f9a86ff6a2a32b5554fd07d177; length=379; release=r1.3; species=Dwil;
Sequence
MALCQTSVLKVYHAVIEDVISNVRDAFLDEGVDEQVLQEMKQIWRNKLMASKAVELNQEQ
SDSGPHPPPIVANNPKSNKAANAKAKKAAAAAATSQQNSASGTSSNSKLVAKSPAPSNMG
NGPKNGLVAIKQEVTSQNPPPLHPTAGALLQQKQQQQQQQQQQQQQQQAASSGGQGPIPI
VASLDPNRIMPVNITLPSPPGSATAESRVLTIQVPASALQENQLTQILTAHLISSIMTLP
TTLASSVLQQHVNAALSNANHQKSLAAAKQLDGALDSSDEDESEESDDNIDNDDDDDLDK
DDDEDVEHEDAAEEEPLNSEDDVTDEDSAEMFETENVIVCQYDKITRSRNKWKFYLKDGI
MNMRGKDYVFQKSNGDAEW
Download sequence
Identical sequences FBpp0251717 7260.FBpp0251717

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]