SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0239402 from Drosophila willistoni 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0239402
Domain Number 1 Region: 7-133
Classification Level Classification E-value
Superfamily PapD-like 5.76e-38
Family MSP-like 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0239402   Gene: FBgn0212274   Transcript: FBtr0240910
Sequence length 237
Comment type=protein; loc=scf2_1100000004401:complement(1256524..1256553,1257027..1257065,1257171..1257269,1257338..1257556,1257611..1257720,1257791..1257943,1259992..1260055); ID=FBpp0239402; name=DwilGK10259-PA; parent=FBgn0212274,FBtr0240910; dbxref=FlyBase:FBpp0239402,FlyBase_Annotation_IDs:GK10259-PA,GB_protein:EDW72210,REFSEQ:XP_002061224,FlyMine:FBpp0239402; MD5=7e5a3a015318a1005ba90d06c64d82c6; length=237; release=r1.3; species=Dwil;
Sequence
MSKPHFDVPLTIEPEHELRFVGPFNRAVVTIMTLRNNSAMPLVFKIKTTAPKRYCVRPNI
GKIAPFRSTQVEICLQPFMYDQQEKNKHKFMVQSVLAPNDADLTDLNKLWKELEPEQLMD
AKLKCVFEMPSSEANAENNSSGNVAGGGSGISAGAGVNTSSTSGEANKVGDGISKLASNE
DKTSIMSDAIESMTGEIKTLRECNSELRTENLKLKDQVTRFRSSTVKPFSQEIQKEQ
Download sequence
Identical sequences 7260.FBpp0239402 FBpp0239402

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]