SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0240199 from Drosophila willistoni 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0240199
Domain Number 1 Region: 317-410
Classification Level Classification E-value
Superfamily TAFH domain-like 9.16e-33
Family TAFH domain-like 0.00034
Further Details:      
 
Domain Number 2 Region: 755-804
Classification Level Classification E-value
Superfamily Histone-fold 0.0000000000000408
Family TBP-associated factors, TAFs 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0240199   Gene: FBgn0213067   Transcript: FBtr0241707
Sequence length 969
Comment type=protein; loc=scf2_1100000004540:complement(2522510..2522680,2523200..2523325,2523391..2523564,2523667..2524617,2524768..2524995,2525070..2525183,2525262..2525744,2527382..2527609,2528145..2528309,2529443..2529712); ID=FBpp0240199; name=DwilGK11056-PA; parent=FBgn0213067,FBtr0241707; dbxref=FlyBase:FBpp0240199,FlyBase_Annotation_IDs:GK11056-PA,GB_protein:EDW76998,REFSEQ:XP_002066012,FlyMine:FBpp0240199; MD5=6557fbc123db15e809a9606f60a4cfbd; length=969; release=r1.3; species=Dwil;
Sequence
MNSSQTAAAGNRITFTTTNSQPMPNGSINIAAGGQTNPTIISTSQLPNTTTIKTIQAAGG
AQAGHPALHHHQQHQQQQQQQQQQQQQTQSAGQPLLNSMLPAGVVVGMRPQAPQPQQPKA
VPANPLGRVVISNSHMAGVRPQSPSITLSTLNTGQTPALLVKTDNGFQLLRMGTATTTGP
PTVTQTITQTNSNNNNNSNTTTTSNHPTTTQIRLQTVPAAASLTSTTASNNIIVNSVASS
NAHGGYATTTVSQPPHLTQLNSQAPHLPQITQIQTIPAQPQSQQQQQSNSLPAGGASTGA
TGAGTTTTTTTTAQQGNTKEKCRKFLANLIELSTREPKPVEKNVRTLIQELVNANVEPEE
FCDRLERLLNASPQPCLIGFLKKSLPLLRQALYTKELVIEGIKPPPQHVLGLAGLSQQLP
KIQAQIRPIGPSQTTTIGQTQVRMITPNALGAPRPTIGHTTISKQPPNIRLPNAPRLVNT
GAIRGQLPALQVPTQANIVQIRGPQHAQLQRTGSVQIRATPRPPNSTQPTNKLTAVKVGQ
TQIKAIQTPSLHPPSLAAISNSGPPPTPTLSVLSTLNSASTTSLPIPSLPTVLLPPEALR
AREQMHNSLHHNNNNNHFEAKLVEIKAPVPHMERINASLTPISAKAMPKASPAATKAASK
KKRDALDKDSKDEMSRAGGGGSGSAGLGGSGSGASAAAAANSFFQQSSMSSSMYGDDDIN
DVAAMGGVNLAEESQRILGCTENIGTQIRSCKDEVFLNLPALQARIRALTTEAGLEEPSQ
DVAVLISHACQERLKNIVEKLAVIAEHRIDVIKLDPRYEPAKDVRGQIKFLEELDKAEQK
RHEEVEREMLLRAAKSRSRVEDPEQAKMKARAKEMQRAEMEELRQRDANLTALQAIGPRK
KLKLDSDATSAGVGSGGGGRGSGMLSSSGSASTTLRPRIKRVNLRDMLFYMEQEREFCRS
SMLFKTYLK
Download sequence
Identical sequences 7260.FBpp0240199 FBpp0240199

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]