SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0240664 from Drosophila willistoni 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0240664
Domain Number 1 Region: 403-644
Classification Level Classification E-value
Superfamily TPR-like 3.03e-25
Family Tetratricopeptide repeat (TPR) 0.0096
Further Details:      
 
Weak hits

Sequence:  FBpp0240664
Domain Number - Region: 17-109
Classification Level Classification E-value
Superfamily TPR-like 0.000506
Family Tetratricopeptide repeat (TPR) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0240664   Gene: FBgn0213532   Transcript: FBtr0242172
Sequence length 720
Comment type=protein; loc=scf2_1100000004902:complement(708200..708559,708621..709269,709333..709590,709652..709940,709999..710509,710584..710679); ID=FBpp0240664; name=DwilGK11521-PA; parent=FBgn0213532,FBtr0242172; dbxref=FlyBase:FBpp0240664,FlyBase_Annotation_IDs:GK11521-PA,GB_protein:EDW80525,REFSEQ:XP_002069539,FlyMine:FBpp0240664; MD5=b51fe0bc289267e3d46ba232134a5e6e; length=720; release=r1.3; species=Dwil;
Sequence
MAGDTENSSSDTTSDQIDLSVYRKLVKQFIEMRRYGTALFWAEKVAVLSNQEPRDIYYQA
QCMFLLGEFHRAAHTIHHHKLEKSSLPCFNLLLESLYAAKEFNEAVNVIQTVEVELMTIS
LINQPVEAGSGYYMESNSVFGGEENYRNELLSSIYLMKGKVYEAMDNRGMAMDFYIQALH
KSVYCFEALEALVQHEMLMAWEEFELMQHLPLAQQSSETDAKLILKLYESKLKKYYELIT
ARTADEISPIVNPDVLQFINEFTVRIQQKNKEPEKEPPAAPKTGVPKAPLFQFMSPAQKV
LEDLKAPTFSLQTSLSRASSMMDASHRSLFDSSSRRRSRDMENTLLMSLGDCLNRIQRST
DLMAAEAEKCFYDCDYKQCLKILNDLLKMDPFHNNALTIQIACLVEHGDFNRLFYVAHKL
VDRYPDKAIAWYAVGCYYDMIGKSDPARRYLSKATALDRLYGPAWLAYGHSFANENEHEQ
AMAAYFKATQLMRGCHLPLLYIGVECGLTKNLELAEKFFLQAMTIAPLDVCVLHELGVIK
YEYEYYEGAEAIFQCTVDIVKQRAKTNGEEISSRWEPLYINLGHACRKVQKYEEALVNFK
FALLLKPQTATTYTSIGFIHALLGYLDPAIEYFHKSLSLNRDCIVTSTILKTCIEDLMDD
PATIDEICGAALADVTKSITDSSRRVLNSDKFNGMKLKFDEEEEFTNTDSNMAVDMSFDT
Download sequence
Identical sequences B4N992
7260.FBpp0240664 XP_002069539.1.14588 FBpp0240664

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]