SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0240799 from Drosophila willistoni 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0240799
Domain Number 1 Region: 233-356
Classification Level Classification E-value
Superfamily TPR-like 4.22e-30
Family Tetratricopeptide repeat (TPR) 0.00084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0240799   Gene: FBgn0213667   Transcript: FBtr0242307
Sequence length 464
Comment type=protein; loc=scf2_1100000004902:join(2040244..2040513,2040570..2041006,2041063..2041190,2041250..2041377,2041438..2041869); ID=FBpp0240799; name=DwilGK11656-PA; parent=FBgn0213667,FBtr0242307; dbxref=FlyBase:FBpp0240799,FlyBase_Annotation_IDs:GK11656-PA,GB_protein:EDW80669,REFSEQ:XP_002069683,FlyMine:FBpp0240799; MD5=05977927045d8003e813b2a9978387e2; length=464; release=r1.3; species=Dwil;
Sequence
MEQKRKSLLEKYNIPLSHLDFGYVKNCGNAREMEKIVNILRSGEEGFYPDLTRCAEDKLK
ELKPNSQLFRYEEPIQRSEFLDRKELKPIYDWTHDIKSKDSTLNEMKEDIRTLKANLPPM
RTPSKIDTDKSATDADTAKPMPNPSVPTAKATKSSENRIKSTDYNKWDKYDPDVEILRMD
LDEERAKEEAEQKNAKNVAPPKKAVDKTDENERLKERLMSRLEQLSKLERDHLAEKHRLR
GNEYFKSKEYKSAILEYSQAIIYDPENASRSYNNRAISHLKVKNYLAAISDCEACLEIEP
DNIKALLRLADANYGQGRRRESHDVYQRVLQLDPSNACALKSLEELHKQLGEIAPANATR
LVIEELPPEVKPKPKANPKASPKVVEPKATKPTKDYDLAELVKPNRMVKNKILNASDALV
GKESIKQKQGPIQELTDADSSPSMLRMPLANKRIDNNKILIEEL
Download sequence
Identical sequences B4NA26
FBpp0240799 XP_002069683.1.14588 7260.FBpp0240799

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]