SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0240919 from Drosophila willistoni 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0240919
Domain Number 1 Region: 429-679
Classification Level Classification E-value
Superfamily TPR-like 5.88e-38
Family Tetratricopeptide repeat (TPR) 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0240919   Gene: FBgn0213787   Transcript: FBtr0242427
Sequence length 702
Comment type=protein; loc=scf2_1100000004902:4005914..4008022; ID=FBpp0240919; name=DwilGK11776-PA; parent=FBgn0213787,FBtr0242427; dbxref=FlyBase:FBpp0240919,FlyBase_Annotation_IDs:GK11776-PA,GB_protein:EDW80903,REFSEQ:XP_002069917,FlyMine:FBpp0240919; MD5=312fe03649823839c1f72f4bc981c48d; length=702; release=r1.3; species=Dwil;
Sequence
MMSFGQLHGLTCQAILVLMCLICYGCGGLSGAKFVFDDTVAIVRNKDVNSLPTNLTAIFT
NDFWGASLLSEDSHKSFRPLTTLMFHYEYALMGLNAGHMKFLNLLLHCLNTLLLWRLVRS
LYIQEINTDRWAIISAALFATHPIHTEAVSGVVGRAELMFGLIHLLCLLLVVANVERQSW
TSIALILALTGIGMLFKESAITIPISCVLLDYFQNGYYMLPFRDQERILRTRLSYLVCVA
GTASLLLARLWWQNFEAPQFKEVDNPIAHNEHILTRVLSQQYLLVMNLWLMLCPQWLCYD
WALGCVKLVTSIWDLRLQGVIGFYSILLVALMHFRRLPGLMLGLGLTIIPFLPASGIIRV
GFVIAERTLYVPSIGFCLMSIYGFLYWYDQGFNKTHWSTMMQGMLLMLIAVMMMRTRQRT
IDWLNEEQLFKSALQVCPDNAKVHYNIARLATDTGNNSKAFHHYHRAIDLYPAYESALMN
LGNLYREHGQLETAEKFIRLALEVYPAFPVAWMNLGIVQSAQKKYSQALASYERALSYRA
NYAVCFYNMGNLYLEQQLYAEALHHWQHAVALNPKQPKAWANILTMLDNRALYEDALRLS
SQALTHMPDEVSILFIRANVLGKQKHYMEAEALYKRVIQLAPHNMLYHTNLGVLYHRWDK
LQEAIEEYQTAISLNAARAITARENLAKLIKRLEREAQMKHQ
Download sequence
Identical sequences B4NAT9
FBpp0240919 XP_002069917.1.14588 7260.FBpp0240919

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]