SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0240957 from Drosophila willistoni 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0240957
Domain Number 1 Region: 62-94,273-355
Classification Level Classification E-value
Superfamily TPR-like 0.0000000325
Family Tetratricopeptide repeat (TPR) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0240957   Gene: FBgn0213825   Transcript: FBtr0242465
Sequence length 497
Comment type=protein; loc=scf2_1100000004902:join(4576824..4577143,4577227..4577828,4577892..4578169,4578230..4578523); ID=FBpp0240957; name=DwilGK11814-PA; parent=FBgn0213825,FBtr0242465; dbxref=FlyBase:FBpp0240957,FlyBase_Annotation_IDs:GK11814-PA,GB_protein:EDW80979,REFSEQ:XP_002069993,FlyMine:FBpp0240957; MD5=c651bcf839db159b810c309124503093; length=497; release=r1.3; species=Dwil;
Sequence
MSAEAEAIVTAGAADASDEPIKKSVDPVAATPDTTPDNGVLETEGTGNSEQDRAEKILKA
KELFSQGSRNFLVKSYDEAADELSQVCQIYEEVYGELANELGQPLLLYAKSLIAMALDEN
KVIDVPDEAGNEDDDDEDMDDADDEEKSEESKSNGAASTNDKKKLESIKEGSGSDEADST
GDAELPKSETATKKPPTGVDEVSSSNGGPSSNDDERPSTSNGEAAASTSNGAATPNLDIE
DEQMEDEAEAEEGVSGSLQLAWEILEAAAKIFSRQGLSGLSYLAEVQTELANIEFENGIL
DAAREDYEKALKIHAELPTQNRRALAELHYKIGLTYLMQQLNKEGATALRNSSALIEEEI
GEIKSKEEPTEREKNNMLDLEETKQEILAKIQEIEEMQAQTIAEVRAALDSYIKPMSSGN
GEAAATSSTSSSTNGASSSFSSSSGAAAAATSAASSSAISSSSTKPTDITHLIKRKKPEE
PSSEAEALCSPAKRPAV
Download sequence
Identical sequences B4NB15
FBpp0240957 7260.FBpp0240957 XP_002069993.1.14588

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]