SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0241505 from Drosophila willistoni 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0241505
Domain Number 1 Region: 2-121
Classification Level Classification E-value
Superfamily PapD-like 3.4e-19
Family MSP-like 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0241505   Gene: FBgn0214372   Transcript: FBtr0243013
Sequence length 144
Comment type=protein; loc=scf2_1100000004830:join(828267..828380,828442..828762); ID=FBpp0241505; name=DwilGK12362-PA; parent=FBgn0214372,FBtr0243013; dbxref=FlyBase:FBpp0241505,FlyBase_Annotation_IDs:GK12362-PA,GB_protein:EDW80047,REFSEQ:XP_002069061,FlyMine:FBpp0241505; MD5=709805898cd954c10da444cd262e206d; length=144; release=r1.3; species=Dwil;
Sequence
MEQNLIQVSPADSLIFSSQITTPILVVTNTVNKPVTFKLQSTVFDKFKISPRRGILNPYE
RIEVRVSLIRQSSIISKKGRDRILVLCMLTPSSAMEVETTSCFWRHNICYNPSVEKHQIY
CRQMVETEDEPHESGLAIKQQGSQ
Download sequence
Identical sequences B4N6Q8
7260.FBpp0241505 FBpp0241505 XP_002069061.1.14588

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]