SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0243433 from Drosophila willistoni 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0243433
Domain Number 1 Region: 1010-1119
Classification Level Classification E-value
Superfamily PDZ domain-like 2.1e-24
Family PDZ domain 0.00015
Further Details:      
 
Domain Number 2 Region: 269-359
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.51e-24
Family Ras-binding domain, RBD 0.00019
Further Details:      
 
Domain Number 3 Region: 387-481
Classification Level Classification E-value
Superfamily SMAD/FHA domain 6.35e-20
Family FHA domain 0.00042
Further Details:      
 
Domain Number 4 Region: 40-130
Classification Level Classification E-value
Superfamily Ubiquitin-like 8.27e-18
Family Ras-binding domain, RBD 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0243433   Gene: FBgn0216296   Transcript: FBtr0244941
Sequence length 2799
Comment type=protein; loc=scf2_1100000004943:join(12900583..12900687,12900748..12900856,12900916..12901109,12901182..12901736,12901811..12901892,12916860..12917212,12919253..12919374,12920402..12920456,12920535..12920615,12920682..12920863,12921218..12921427,12922358..12922823,12922895..12923419,12923488..12923735,12923798..12923916,12924149..12926257,12927333..12927569,12927710..12927977,12929257..12931330,12931392..12931504,12931564..12931756); ID=FBpp0243433; name=DwilGK14290-PA; parent=FBgn0216296,FBtr0244941; dbxref=FlyBase:FBpp0243433,FlyBase_Annotation_IDs:GK14290-PA,GB_protein:EDW84765,REFSEQ:XP_002073779,FlyMine:FBpp0243433; MD5=d4728cb277949bb914e90b33a37a9dac; length=2799; release=r1.3; species=Dwil;
Sequence
MSHDKKMLDREAVRSVIQQWNANRLDLFALSEPDENLLFHGVMRFYFQDAGQKVATKCIR
VASDATVTDVIDTLIEKFRPDMRMLSVPNYALYEVHANGEERRLNADEKPLLVQLNWHID
DREGRFLLKNIDQKTTPIEQTDLNFKRKLSKREKKEQKKKEKMAKLSSDQPLANGNQSGM
GNGLGGGSGAAGSIAAAGGNSSHMNGHAGGAGGVGDPDAVAGKLYTELPETSFTRSISNP
EAVMRRRRQQKLEKKLQQFRSRDGGPDTGGTLKIYGESLCQDVPYKTLLLSIRDCAQAVV
REMLTKYGLEKSDPLLYCLVQVNSDGSEYILDDDECPLSILMNHPTSRGSIMFHVRRRPA
DSQPRRRKKKPLGTSNGANHMSGDREGPVLVEVTHSGDGGRRIKLGSDPVEVGSANTNCL
QLFGPSIQPRHCLISLHEGVCTVTPLHTDALTFVNGHHISQPTILHNGSVVMFGRVASYR
FLDSPTDGRYNLALSQSQLDSACLYESRSPTSPGSWNDEDGALSSTHKSEYDHHHHQQQH
QQQQQQQHQQQSQHPLNSLRDVVDSKHTQQDQQVGLGNNSSNAFDGQSLEGNLENETKSI
SSMKSGGSNSQDRSPKMPGSGLLAGAGGGSAGDGQGQEPILPAVLEFPETHQELFLRHII
SELDVNIPHFKLAPVYSLYLCARYRASTHYRPELQPTERAHKLTIFLHHVANLVYSVVQE
QYTDPRILAFWMANSSEFLHFLKSDRHISAFSVQAQEVLAEAVQTAFRNLVNCFRLELSQ
TLNQFLSETIDHDSAAGLVLTVLGSAMALLRRCRVNAALTIQLFSQLFHYINVICFNTIV
ANSHMCTGDWGKVMIERLQLLELWAERQGLELAADCHLAKINQCAQFLQAPKSSVEEIQQ
LACSCFRLNSLQMAALLQQEKIPRNLVDTAIRMAESVADELTRADGREVRLEESPELHLA
LLLPDDGFSCDVVRGIPTGLVDFLNPLQQQGMCRLAAQPTSIGLWTVYMHQFNARSSSSM
SNKLPQPEIQLIKLHKNSNGMGLSIVAAKGAGQERLGIYIKSVVPGGAADADGRLQAGDQ
LLRVDGQSLIGITQERAADYLVRTGPIVSLEVAKQGAIYHGLATLLQQPSPVIQREAPMS
NNFLQQHQQPQQRRHSSYQQQNRYYNNSISDDSLNRSRRESFACMRASSPPVRRLSASCL
QEELCAMGHQLHIDPRYRDTRPIARSASSLYLSNERLGGGGPSSSANYYPYHQQTAASSS
MVNQHFSPMRPLRHTPPPSIYIEEYQDEPKCNEEEAVAGSAARSSQESFKSFAAYTEAHQ
PLNEEGIASVADSDDIPFIDDEDDEKPPIPPPPPAIELASVSGSTVKRIAAAHGNGYRKT
VSFDLEQPTTSGSKIDRKYHTHDAISKLSAPAVNSSTESLNERIPLIQKIRRELNSKRST
NSASSAGYGSGGSGSNSQRSSSESIERMPLIRHNNNSSNNNNNIIQRQLNTQRSHKRSHQ
VPNLCEIESSCTNLINHVNTSTQNRTERPEIATDTKIIRLTQHRPGRSSSQVNLSCPHDH
HLLLPPLGHGKVREMANYFNANQSFASPIAASNGSSSSSSTNNKTNNHNNNMKNKSRSTS
ALNPKNDSRLSHNEQGHILKQLKEWSLFGSSGKDFDIKLPREKQNTSSCDCPCCGHCRGN
KQQSEQIQQEEKPTANASSFKCYDSCQDVEEDEQQIQQQELSRHVTCRRSVMCSNRQVAS
VRQMKRQQQQHQQQRQQQGPHHGHLHTLHHRHHHQNHRHRRHCQVPTPPSSPPSTAKLLL
LSLANKEDSAGCCQQDASATTYDYSDVESCSCDGGAGGGNRRMSERDLTRMGGAESTKSL
GGIGGHATAHSLSLSQHLNNSHSISNSNSSILNPLAAHLPNSKSVPALHHHTGSGTISLA
NSKSRSTHSLHNNTSAGGAAAATGTTMGIGGVGVGGQPNGNGHNMANGMGNGLGNANGNG
NGNEQGFYQNLSVYRAQNQSQPMLNERPPMSSNAAMSNYNGNSPLVAAGTLSPQQHQPTP
YQQQLGNLPPSRPVSAYYHSQQTAQQQLQQQQQQQQQQQHALQQQQFAHSSSNLNGQQQQ
QQLTLNNRGKSQPNFQHTLRMQQMMAPSMPNISHMYQQQQQQQQQHHPLHQQQQGQQQQL
PPMSSSQSMQNVNDFAGGYPNGVLEYHQARRSQLHEPQPATLYEQQQPSPNFITLPPKPL
GGALQSPNKPSALPPSTAPKPQQQQQQRLSHHVMGEDKPPLPPTATHPLYKATQQIAPGM
NYVASTLDPPKGSYVPGGNPLQANRPSQHTGSNPWEREEREKDLEMRREHIRQWREQQIN
ELSQLISRSPQQEEQLKTLILERDFERRAQELQEQEDQDQEQQYDKENNVQELIRLAHGQ
QQQLSSAIQTPLTTYRQTEIKLAEITESSNGSGAGAGSVPMAEMSQPPPPPPVSQQTQPK
SILKHNRYSEGGAGGLGGTTAPSSPSKSQKSASFADERHLHTEHPISSLAKEMTHLSMLD
KDNNNEQLDSATVPPPPPPERNSSYLIMSQQKLRGGTGNTSSTTNTTTSTSMGLLKTASN
NLEIKKASLLNTQNNNNHNLTNNNNNNNTMQASPISAMELNAAYVSASSGMIQGLGLGLG
GTPPPPLPPQMQRDNKRVSFHDEDNTAQQQQQQQQQQYMIDNYGLEHLDLDTIREDSSYN
IDASMLPSMPSTPDVALWNTTVQSTPGVIGAQEVYRDPRQRRLAEKQQQQQQQRAGDGVP
EKLSFKEKMKMFALESGEDNTPKDKLKISRAQRDIDAVH
Download sequence
Identical sequences FBpp0243433 7260.FBpp0243433

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]