SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0243803 from Drosophila willistoni 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0243803
Domain Number 1 Region: 324-541
Classification Level Classification E-value
Superfamily TPR-like 6.45e-21
Family Tetratricopeptide repeat (TPR) 0.018
Further Details:      
 
Weak hits

Sequence:  FBpp0243803
Domain Number - Region: 226-362
Classification Level Classification E-value
Superfamily HCP-like 0.000178
Family HCP-like 0.036
Further Details:      
 
Domain Number - Region: 2-34
Classification Level Classification E-value
Superfamily TPR-like 0.0656
Family Tetratricopeptide repeat (TPR) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0243803   Gene: FBgn0216666   Transcript: FBtr0245311
Sequence length 555
Comment type=protein; loc=scf2_1100000004521:complement(9035871..9037147,9037218..9037608); ID=FBpp0243803; name=DwilGK14660-PA; parent=FBgn0216666,FBtr0245311; dbxref=FlyBase:FBpp0243803,FlyBase_Annotation_IDs:GK14660-PA,GB_protein:EDW76438,REFSEQ:XP_002065452,FlyMine:FBpp0243803; MD5=64ba02cdcf55e63c215fc1b116519663; length=555; release=r1.3; species=Dwil;
Sequence
MELEYFRAVSLYRRRSYEQCAEMCNALLQSGHENNVQMFATNEKEDEEEDQAAATTTTAA
GGGETNSSSSRYGSNLQRIGPRRRNEPRRAGGDNAMPTWLMEGVWQLKMRALTQRVYLDD
LEADDVAGNEAQEEVEFERIATAARPGSSIKTAFQPRPSTSQLMKNRHSSDGRLNSTTSR
PTSAAAVARPGTSLSRPGSASRPVSRCGTAARVRSTSATAFNVADATSKLYQASRLNPTI
YAERQTLVKALFQFLYYHEADVQKAYSLCQAVMEVQRQRPSNPSEPSPRFDWWWQQQMGR
CLLALNYPRRAEPCLLQSLNVFPHPDTYLLLSRVYQRLKQPERALILIGQIVEQRPFDIT
YRLEQARVYQSMGEPKQEDALQLYRLVAKLQPINIEALANIAMNYFYDNNPEMALMYYRR
ILSLGVHSVELYCNIALCCLYGGQIDLVLPCFQRALALVTSASTSSLAEQRADVWYNLSF
VALTSGDFLLARRCLQLCLTSDARHGAALNNLAVLSAQNGDVMAAKSYLTAAQDVAPDSL
EVSSNIQFMDLHYKL
Download sequence
Identical sequences B4MV93
7260.FBpp0243803 FBpp0243803 XP_002065452.1.14588

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]