SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0246106 from Drosophila willistoni 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0246106
Domain Number 1 Region: 474-559
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000451
Family Anti-sigma factor antagonist SpoIIaa 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0246106   Gene: FBgn0218962   Transcript: FBtr0247614
Sequence length 614
Comment type=protein; loc=scf2_1100000004511:complement(2917374..2917495,2917705..2917884,2917948..2918620,2918687..2918962,2919034..2919627); ID=FBpp0246106; name=DwilGK16963-PA; parent=FBgn0218962,FBtr0247614; dbxref=FlyBase:FBpp0246106,FlyBase_Annotation_IDs:GK16963-PA,GB_protein:EDW72842,REFSEQ:XP_002061856,FlyMine:FBpp0246106; MD5=577bfbd11b38dcf0ea1f04456d8efcda; length=614; release=r1.3; species=Dwil;
Sequence
MPLKDLGYRLLPGLKWLHGYTAQDAVADLIAGITVGLTVLPQGLAYATLAGLEPQYGLYS
AFVGGIVYALLGSCRQVTIGPTALLALMTSRHTGFGLGSGPTYAILLCLISGVVELAMAV
LKLGALVDLISLPVTVGFTSATAVIIGTSQLKGLLGLRGGSGSDFINTMKSVFGNLQHVR
QGDVTLGLTSIMVLLLLRKLKNVKLANRVRSLRAQQLISGTIWVIATGRNALVVLVASVL
AYSTCEQMETCPYILTGKVKSGLPNVALPKFETTILGKNGTQITQDFEAMLSELGPSMII
LPIIAVLGNVAISKAFGGAGLSPTRELVALSMSNICGAFCSSMPVTGSFSRSAVNHASGV
RTPIGGCYTSVLVLLALGLLAPYFQYIPKAALSAVIISAVIFMIEFEVIKPLWRCSRREL
LPGAITFVMSLAVGVEIGLLLGVGADVAFLVYRAARPVLSVSKLQTINGINYILIRPKHS
SLYFPAIEWVRSGISKALSIHGTAPVVLDCAHVHDFDFTAARGMGSLYKELAKANVPLFL
MSAHKDIGLILKESTNIDFPTIDTPDDLECLLEQTHDYELQLQVTAPLVESQLIHRNPTV
DEPTELSKLNGTGT
Download sequence
Identical sequences B4MLI6
7260.FBpp0246106 XP_002061856.1.14588 FBpp0246106

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]